(data stored in ACNUC7421 zone)

EMBL: CP001022.PE78

CP001022.PE78        Location/Qualifiers
FT   CDS             107080..107721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0079"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-H factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bwe:BcerKBAB4_0088 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59566"
FT                   /db_xref="GOA:B1YGT3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGT3"
FT                   /protein_id="ACB59566.1"
FT                   /translation="MSLVSFDQFECMTDEALVEQAKVFDNSDALEFLIERYRNFVRAKA
FT                   RSYFLIGADREDIIQEGMIGLYKAVRDYRTDKLASFKGFAELCITRQMITAIKTATRQK
FT                   HIPLNSYISLDKPIYDDESERTLLDIITSTAPSDPQVLIVNREEYADIESKMDEILSDL
FT                   ERKVLALYLDGRTYQEISDDLDRHVKSIDNALQRVKKKLERYLEARKLTV"
     MSLVSFDQFE CMTDEALVEQ AKVFDNSDAL EFLIERYRNF VRAKARSYFL IGADREDIIQ        60
     EGMIGLYKAV RDYRTDKLAS FKGFAELCIT RQMITAIKTA TRQKHIPLNS YISLDKPIYD       120
     DESERTLLDI ITSTAPSDPQ VLIVNREEYA DIESKMDEIL SDLERKVLAL YLDGRTYQEI       180
     SDDLDRHVKS IDNALQRVKK KLERYLEARK LTV                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page