(data stored in ACNUC7421 zone)

EMBL: CP001022.PE79

CP001022.PE79        Location/Qualifiers
FT   CDS             107879..108025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0080"
FT                   /product="ribosomal protein L33"
FT                   /note="PFAM: ribosomal protein L33; KEGG: ssp:SSP2221 50S
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59567"
FT                   /db_xref="GOA:B1YGT4"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGT4"
FT                   /protein_id="ACB59567.1"
FT                   /translation="MAKKVGLACDICGARDYTTMKKEDVSIRLELKKFCRRCNAHTIHK
FT                   EAK"
     MAKKVGLACD ICGARDYTTM KKEDVSIRLE LKKFCRRCNA HTIHKEAK                     48
//

If you have problems or comments...

PBIL Back to PBIL home page