(data stored in ACNUC7421 zone)

EMBL: CP001022.PE81

CP001022.PE81        Location/Qualifiers
FT   CDS             108260..108811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0082"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: NGN domain protein; KEGG: lwe:lwe0209
FT                   transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59569"
FT                   /db_xref="GOA:B1YGT6"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGT6"
FT                   /protein_id="ACB59569.1"
FT                   /translation="MDKQWFVVQTYSGFENNVKANLERRIESMNMDEKIFRVLVPIETV
FT                   QEEVTNKKGETKIKEREIKIFPGYVLVEMVMTDDSWYVVRNTPNVTGFLGSVGGGSKPT
FT                   PLLPEEAENILGSMGLVDMKSRYDFTMGQIVRIKEGVFANLEGTIEELETEAEKMKVSV
FT                   DMFGRETKVELDFSQVEKID"
     MDKQWFVVQT YSGFENNVKA NLERRIESMN MDEKIFRVLV PIETVQEEVT NKKGETKIKE        60
     REIKIFPGYV LVEMVMTDDS WYVVRNTPNV TGFLGSVGGG SKPTPLLPEE AENILGSMGL       120
     VDMKSRYDFT MGQIVRIKEG VFANLEGTIE ELETEAEKMK VSVDMFGRET KVELDFSQVE       180
     KID                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page