(data stored in ACNUC7421 zone)

EMBL: CP001022.PE82

CP001022.PE82        Location/Qualifiers
FT   CDS             108961..109386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0083"
FT                   /product="ribosomal protein L11"
FT                   /note="PFAM: ribosomal protein L11; KEGG: bpu:BPUM_0087
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59570"
FT                   /db_xref="GOA:B1YGT7"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGT7"
FT                   /protein_id="ACB59570.1"
FT                   /translation="MAKKVMKLVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNAR
FT                   TQDQAGLIIPVVITVFEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRKKVATVKRDK
FT                   VREIAETKMPDLNAASVETAMLMVEGTARSMGIVIED"
     MAKKVMKLVK LQIPAGKANP APPVGPALGQ AGVNIMGFCK EFNARTQDQA GLIIPVVITV        60
     FEDRSFTFIT KTPPAAVLLK KAAGIESGSG EPNRKKVATV KRDKVREIAE TKMPDLNAAS       120
     VETAMLMVEG TARSMGIVIE D                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page