(data stored in ACNUC7421 zone)

EMBL: CP001022.PE83

CP001022.PE83        Location/Qualifiers
FT   CDS             109503..110189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0084"
FT                   /product="ribosomal protein L1"
FT                   /note="PFAM: ribosomal protein L1; KEGG: btl:BALH_0096 50S
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59571"
FT                   /db_xref="GOA:B1YGT8"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGT8"
FT                   /protein_id="ACB59571.1"
FT                   /translation="MGKKYKEAAKLIDRTVSYELAEAVDLTKKSATAKFDETIELAVRL
FT                   GVDPKKADQQIRGAVVLPHGTGKTQKVLVFAKGEKLKEAEAAGADFAGDSEYITKIQQG
FT                   WFDFDVIVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVTKAINDIKAGKVEYRVD
FT                   KSGNIHVPVGKKSFDDAKLVENINTVIETLVKVKPATAKGVYLKNIAIASTMGPGVKVS
FT                   AVDFAK"
     MGKKYKEAAK LIDRTVSYEL AEAVDLTKKS ATAKFDETIE LAVRLGVDPK KADQQIRGAV        60
     VLPHGTGKTQ KVLVFAKGEK LKEAEAAGAD FAGDSEYITK IQQGWFDFDV IVATPDMMGE       120
     VGKLGRVLGP KGLMPNPKTG TVTFDVTKAI NDIKAGKVEY RVDKSGNIHV PVGKKSFDDA       180
     KLVENINTVI ETLVKVKPAT AKGVYLKNIA IASTMGPGVK VSAVDFAK                    228
//

If you have problems or comments...

PBIL Back to PBIL home page