(data stored in ACNUC7421 zone)

EMBL: CP001022.PE87

CP001022.PE87        Location/Qualifiers
FT   CDS             112308..115865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0088"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase Rpb2 domain 2; RNA polymerase beta
FT                   subunit; RNA polymerase Rpb2 domain 3; KEGG: btl:BALH_0100
FT                   DNA-directed RNA polymerase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59575"
FT                   /db_xref="GOA:B1YGU2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGU2"
FT                   /protein_id="ACB59575.1"
FT                   /translation="MTGQLVQYGRHRQRRSYARISEVLELPNLIEIQTNSYEWFLREGL
FT                   REMFHDISPISDFTGNLVLEFIDYSLGEPKYSIDESKERDVTYSAPLRVKVRLQNKETG
FT                   ELKEQEVFMGDFPLMTESGTFIINGAERVIVSQLVRSPSVYYNNKLDKNGKRGFSATVI
FT                   PNRGAWLELETDAKDIVYVRIDRTRKIPVTVLLRALGFGTDQEIIDLLGDDEYLRNSLE
FT                   KDNTETTEKALIEIYERLRPGEPPTVENAKALLVSRFFDPKRYDLANVGRCKINKKLHL
FT                   KNRLFGQKLAETLVDPETGEVIAEEGTVLDRRMLDKVLPFLEGSVGYIEATPTGGVTQG
FT                   EAFNLQSIKVFAPDDAEGERIINIIGNGNIDRDIKHITPADMIAAINYFFNLLHEVGTT
FT                   DDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVKERMSIQDQNAITPQALINIRPVIAS
FT                   IKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYSRMCP
FT                   IETPEGPNIGLINSLSSFAKVNEYGFIEAPYRRVDPETGVVTNEIHYMTADEEDLYVVA
FT                   QANMLLTEEKTFQDTHVLSRFRGQNLSVEPARVDYMDVSPKQVVSAATACIPFLENDDS
FT                   NRALMGANMQRQAVPLLDPESPIVGTGMEYVSAKDSGAAVVAKHSGIAERVTAREILVR
FT                   RTTEVDGNIVQGELDRYKIQKFIRSNQGTCYNQKPIIKVGDPVDKGEILADGPSMDGGE
FT                   LALGRNVLVGFMTWDGYNYEDAVIMSERLVKDDVYTSIHIEEYECESRDTKLGPEEITR
FT                   DIPNVGDDALKNLDDRGIIRVGAEVKDGDILVGKVTPKGVTELTAEERLLHAIFGEKAR
FT                   EVRDTSLRVPHGGDGIILDVKIFDRDNGDELSPGVNQLIRAYIVQKRKIHEGDKMAGRH
FT                   GNKGVISRILPEEDMPYMPDGTPIDIMLNPLGVPSRMNIGQLLELHLGMAARQLGIKVA
FT                   SPVFDGAREEDVWATIEEAGMDRDAKTILYDGRSGEAFDNRISVGVMYMIKLAHMVDDK
FT                   LHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTIKSDDTIGR
FT                   VKAYEAIVKGENVPQPGVPESFRVLIKELQSLGMDVKMMSAEDEEIEMKDDDEDNIPNA
FT                   TPALEEVQAPVAPVVTEEE"
     MTGQLVQYGR HRQRRSYARI SEVLELPNLI EIQTNSYEWF LREGLREMFH DISPISDFTG        60
     NLVLEFIDYS LGEPKYSIDE SKERDVTYSA PLRVKVRLQN KETGELKEQE VFMGDFPLMT       120
     ESGTFIINGA ERVIVSQLVR SPSVYYNNKL DKNGKRGFSA TVIPNRGAWL ELETDAKDIV       180
     YVRIDRTRKI PVTVLLRALG FGTDQEIIDL LGDDEYLRNS LEKDNTETTE KALIEIYERL       240
     RPGEPPTVEN AKALLVSRFF DPKRYDLANV GRCKINKKLH LKNRLFGQKL AETLVDPETG       300
     EVIAEEGTVL DRRMLDKVLP FLEGSVGYIE ATPTGGVTQG EAFNLQSIKV FAPDDAEGER       360
     IINIIGNGNI DRDIKHITPA DMIAAINYFF NLLHEVGTTD DIDHLGNRRL RSVGELLQNQ       420
     FRIGLSRMER VVKERMSIQD QNAITPQALI NIRPVIASIK EFFGSSQLSQ FMDQTNPLAE       480
     LTHKRRLSAL GPGGLTRERA GFEVRDVHYS HYSRMCPIET PEGPNIGLIN SLSSFAKVNE       540
     YGFIEAPYRR VDPETGVVTN EIHYMTADEE DLYVVAQANM LLTEEKTFQD THVLSRFRGQ       600
     NLSVEPARVD YMDVSPKQVV SAATACIPFL ENDDSNRALM GANMQRQAVP LLDPESPIVG       660
     TGMEYVSAKD SGAAVVAKHS GIAERVTARE ILVRRTTEVD GNIVQGELDR YKIQKFIRSN       720
     QGTCYNQKPI IKVGDPVDKG EILADGPSMD GGELALGRNV LVGFMTWDGY NYEDAVIMSE       780
     RLVKDDVYTS IHIEEYECES RDTKLGPEEI TRDIPNVGDD ALKNLDDRGI IRVGAEVKDG       840
     DILVGKVTPK GVTELTAEER LLHAIFGEKA REVRDTSLRV PHGGDGIILD VKIFDRDNGD       900
     ELSPGVNQLI RAYIVQKRKI HEGDKMAGRH GNKGVISRIL PEEDMPYMPD GTPIDIMLNP       960
     LGVPSRMNIG QLLELHLGMA ARQLGIKVAS PVFDGAREED VWATIEEAGM DRDAKTILYD      1020
     GRSGEAFDNR ISVGVMYMIK LAHMVDDKLH ARSTGPYSLV TQQPLGGKAQ FGGQRFGEME      1080
     VWALEAYGAA YTLQEILTIK SDDTIGRVKA YEAIVKGENV PQPGVPESFR VLIKELQSLG      1140
     MDVKMMSAED EEIEMKDDDE DNIPNATPAL EEVQAPVAPV VTEEE                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page