(data stored in ACNUC7421 zone)

EMBL: CP001022.PE89

CP001022.PE89        Location/Qualifiers
FT   CDS             119566..119817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0090"
FT                   /product="ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   gtn:GTNG_0100 LSU ribosomal protein L7AE"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59577"
FT                   /db_xref="GOA:B1YGU4"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B1YGU4"
FT                   /protein_id="ACB59577.1"
FT                   /translation="MSYKKVVGADLKFVGQKQTLKALRSGKASEVIIADDADEHVKQAL
FT                   LDAAKQANVPVVNVPSKLELGKACGIDVAATAVAIKKV"
     MSYKKVVGAD LKFVGQKQTL KALRSGKASE VIIADDADEH VKQALLDAAK QANVPVVNVP        60
     SKLELGKACG IDVAATAVAI KKV                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page