(data stored in ACNUC7421 zone)

EMBL: CP001022.PE90

CP001022.PE90        Location/Qualifiers
FT   CDS             119943..120365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0091"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: gtn:GTNG_0101 ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59578"
FT                   /db_xref="GOA:B1YGU5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGU5"
FT                   /protein_id="ACB59578.1"
FT                   /translation="MPTINQLVRKGRQSKVVKSDSPALNKGYNSFIKARTDISSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNTMEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVDGRMQGRSKYGTKRPKAAKK"
     MPTINQLVRK GRQSKVVKSD SPALNKGYNS FIKARTDISS PQKRGVCTRV GTMTPKKPNS        60
     ALRKYARVRL TNTMEVTAYI PGIGHNLQEH SVVLIRGGRV KDLPGVRYHI VRGALDTAGV       120
     DGRMQGRSKY GTKRPKAAKK                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page