(data stored in ACNUC7421 zone)

EMBL: CP001022.PE92

CP001022.PE92        Location/Qualifiers
FT   CDS             121010..123088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0093"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: bca:BCE_0107 elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59580"
FT                   /db_xref="GOA:B1YGU7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGU7"
FT                   /protein_id="ACB59580.1"
FT                   /translation="MAREFSLKNTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWKGNRVNIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTLRDRLQANAHAIQ
FT                   IPIGAEDEFKGIIDLVEKKTYMYGNDLGTDIEETEGFPAEFAEEAEELRASLIEAVADY
FT                   EEEMMMKYLEGEEITIEELKAGIRKATLTVDFYPVLVGSAFKNKGVQLMLDAVLDYLPS
FT                   PVDVKAITGINMDTDEEIVRESTDEAPFSALAFKVMTDPYVGKLTFFRVYSGTASAGSY
FT                   VKNSTKGKRERLGRILQMHANSREEIPMVFAGDIAAAVGLKDTTTGDTLCAEKDNVVLE
FT                   SMTFPEPVISVAIEPKTKADQDKMGQALAKLAEEDPTFRTETNPETGQTIISGMGELHL
FT                   DIIVDRMRREFKVEANVGAPQVAYRETIRQSAKIDSKFARQSGGRGQYGHVVVEFEPNE
FT                   EGAGFEFNNKIVGGVVPREYIPAVEHGIEEALQNGILAGYPVVDVKAALVFGSYHDVDS
FT                   NEMAFKIAASMAVKQLKDKSGAVILEPMMKVEIVIPDEYMGDIMGDVTSRRGRVEGMEA
FT                   RGNAQVVRSMIPLSEMFGYATGLRSRTQGRGTYSMHFDHYEEVPKSVAEEIIKKANG"
     MAREFSLKNT RNIGIMAHID AGKTTTTERI LYYTGRIHKI GETHEGASQM DWMEQEQERG        60
     ITITSAATTA QWKGNRVNII DTPGHVDFTV EVERSLRVLD GAVAVLDAQS GVEPQTETVW       120
     RQATTYGVPR IVFVNKMDKI GADFLYSVGT LRDRLQANAH AIQIPIGAED EFKGIIDLVE       180
     KKTYMYGNDL GTDIEETEGF PAEFAEEAEE LRASLIEAVA DYEEEMMMKY LEGEEITIEE       240
     LKAGIRKATL TVDFYPVLVG SAFKNKGVQL MLDAVLDYLP SPVDVKAITG INMDTDEEIV       300
     RESTDEAPFS ALAFKVMTDP YVGKLTFFRV YSGTASAGSY VKNSTKGKRE RLGRILQMHA       360
     NSREEIPMVF AGDIAAAVGL KDTTTGDTLC AEKDNVVLES MTFPEPVISV AIEPKTKADQ       420
     DKMGQALAKL AEEDPTFRTE TNPETGQTII SGMGELHLDI IVDRMRREFK VEANVGAPQV       480
     AYRETIRQSA KIDSKFARQS GGRGQYGHVV VEFEPNEEGA GFEFNNKIVG GVVPREYIPA       540
     VEHGIEEALQ NGILAGYPVV DVKAALVFGS YHDVDSNEMA FKIAASMAVK QLKDKSGAVI       600
     LEPMMKVEIV IPDEYMGDIM GDVTSRRGRV EGMEARGNAQ VVRSMIPLSE MFGYATGLRS       660
     RTQGRGTYSM HFDHYEEVPK SVAEEIIKKA NG                                     692
//

If you have problems or comments...

PBIL Back to PBIL home page