(data stored in ACNUC7421 zone)

EMBL: CP001022.PE93

CP001022.PE93        Location/Qualifiers
FT   CDS             123206..124393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0094"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: bha:BH0132
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59581"
FT                   /db_xref="GOA:B1YGU8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGU8"
FT                   /protein_id="ACB59581.1"
FT                   /translation="MGKEKFDRSKPHVNVGTIGHVDHGKTTLTAAISAVLAKSQGKAAT
FT                   KFDQIDGAPEERERGITIATAHIEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSATDGPMPQTREHILLSRQVGVPFIVVFMNKVDMVDDEELLELVEMEIRELLSEYDF
FT                   PGDDLPVIQGSALGALNGEAKWEEKIMELMNAVDEYIPEPTRDTEKDFMMPVEDVFSIT
FT                   GRGTVATGRVERGVLKVNDEVEIVGLHEETKKSVCTGVEMFRKLLDYAEAGDNIGALLR
FT                   GVSRDDIERGQVLAKPNTITPHKTFKAQVYILSKEEGGRHTPFFGNYRPQFYFRTTDVT
FT                   GMCQLPEGTEMVMPGDNIELTVELIAPIALEKETRFSIREGGRTVGAGSVTEIVE"
     MGKEKFDRSK PHVNVGTIGH VDHGKTTLTA AISAVLAKSQ GKAATKFDQI DGAPEERERG        60
     ITIATAHIEY ETDKRHYAHV DCPGHADYVK NMITGAAQMD GAILVVSATD GPMPQTREHI       120
     LLSRQVGVPF IVVFMNKVDM VDDEELLELV EMEIRELLSE YDFPGDDLPV IQGSALGALN       180
     GEAKWEEKIM ELMNAVDEYI PEPTRDTEKD FMMPVEDVFS ITGRGTVATG RVERGVLKVN       240
     DEVEIVGLHE ETKKSVCTGV EMFRKLLDYA EAGDNIGALL RGVSRDDIER GQVLAKPNTI       300
     TPHKTFKAQV YILSKEEGGR HTPFFGNYRP QFYFRTTDVT GMCQLPEGTE MVMPGDNIEL       360
     TVELIAPIAL EKETRFSIRE GGRTVGAGSV TEIVE                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page