(data stored in ACNUC7421 zone)

EMBL: CP001022.PE94

CP001022.PE94        Location/Qualifiers
FT   CDS             124712..125020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0095"
FT                   /product="ribosomal protein S10"
FT                   /note="PFAM: ribosomal protein S10; KEGG: bpu:BPUM_0101
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59582"
FT                   /db_xref="GOA:B1YGU9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGU9"
FT                   /protein_id="ACB59582.1"
FT                   /translation="MANEKIRIRLKAYDHRVLDQSAEKIVETAKRSGATVSGPIPLPTE
FT                   KAIYTVLRAVHKYKDAREQFEMRTHKRLIDIVNPTPKTVDALMRLELPSGVDIEIKL"
     MANEKIRIRL KAYDHRVLDQ SAEKIVETAK RSGATVSGPI PLPTEKAIYT VLRAVHKYKD        60
     AREQFEMRTH KRLIDIVNPT PKTVDALMRL ELPSGVDIEI KL                          102
//

If you have problems or comments...

PBIL Back to PBIL home page