(data stored in ACNUC7421 zone)

EMBL: CP001022.PE95

CP001022.PE95        Location/Qualifiers
FT   CDS             125089..125715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0096"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: bha:BH0134 50S
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59583"
FT                   /db_xref="GOA:B1YGV0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGV0"
FT                   /protein_id="ACB59583.1"
FT                   /translation="MAKGILGTKLGMTQIFNESGEVVPVTVVSVEGNVVLQLKTMEVDG
FT                   YEAVQLGFGDIKEGRQNKPQKGHAAKASATPKRFIKEIRTSVTDFEIGQEIKADTFAAG
FT                   EMVDVTGTSKGKGFAGAIKRHNQSRGPMAHGSRYHRRPGSMGPVAPNRVFKGKLLPGRM
FT                   GGEQVTVQNLEIVKVDVERGLLLVKGAIPGARKSQVVVKTAVKGN"
     MAKGILGTKL GMTQIFNESG EVVPVTVVSV EGNVVLQLKT MEVDGYEAVQ LGFGDIKEGR        60
     QNKPQKGHAA KASATPKRFI KEIRTSVTDF EIGQEIKADT FAAGEMVDVT GTSKGKGFAG       120
     AIKRHNQSRG PMAHGSRYHR RPGSMGPVAP NRVFKGKLLP GRMGGEQVTV QNLEIVKVDV       180
     ERGLLLVKGA IPGARKSQVV VKTAVKGN                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page