(data stored in ACNUC7421 zone)

EMBL: CP001022.PE98

CP001022.PE98        Location/Qualifiers
FT   CDS             126685..127515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_0099"
FT                   /product="ribosomal protein L2"
FT                   /note="PFAM: ribosomal protein L2; KEGG: bcy:Bcer98_0107
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACB59586"
FT                   /db_xref="GOA:B1YGV3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1YGV3"
FT                   /protein_id="ACB59586.1"
FT                   /translation="MGIKKFKPTTNGRRNMTALDFAEITASRPEKSLTEKLSKKGGRNN
FT                   QGRLTVRHQGGGHKRKYRIIDFKRNKDGIAGRIATIEYDPNRSANIALVHYIDGEKRYI
FT                   LAPKGLKVDMQVMSGVEADIKVGNALPLSNIPVGTLIHNIELKPGKGGQLVRSAGTSAQ
FT                   LLGKDGKYAIVRLQSGETRMILATCRATVGAVGNEEHELVNIGKAGRSRWLGKRPTVRG
FT                   SVMNPVDHPHGGGEGRAPIGRSGPLTPWGKPALGYKTRKKNKASDKYIVRRSKK"
     MGIKKFKPTT NGRRNMTALD FAEITASRPE KSLTEKLSKK GGRNNQGRLT VRHQGGGHKR        60
     KYRIIDFKRN KDGIAGRIAT IEYDPNRSAN IALVHYIDGE KRYILAPKGL KVDMQVMSGV       120
     EADIKVGNAL PLSNIPVGTL IHNIELKPGK GGQLVRSAGT SAQLLGKDGK YAIVRLQSGE       180
     TRMILATCRA TVGAVGNEEH ELVNIGKAGR SRWLGKRPTV RGSVMNPVDH PHGGGEGRAP       240
     IGRSGPLTPW GKPALGYKTR KKNKASDKYI VRRSKK                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page