(data stored in ACNUC7421 zone)

EMBL: CP001024.PE1

CP001024.PE1         Location/Qualifiers
FT   CDS             49..942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Exig_3056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lhe:lhv_0265 putative replicative protein"
FT                   /db_xref="EnsemblGenomes-Gn:Exig_3056"
FT                   /db_xref="EnsemblGenomes-Tr:ACB62501"
FT                   /db_xref="UniProtKB/TrEMBL:B1YMS4"
FT                   /protein_id="ACB62501.1"
FT                   /translation="MEHEKSSNISPSSTVRVTKMNHLVEVQHMERMNRTNHIQKLDKER
FT                   YLNLKTGEIGEFKQGEVRSDSLNSLRQTFKKLRYLINTNYVGAGNELFITLTYKENMTD
FT                   VKRLYSDFKKFMLKFRYKYEKQYGSIDYMTVVEPQERGAWHHHLLVRFNDMTGSKMYIP
FT                   NNDVAALWGHGFTNMHSLNGVDNIGAYLSAYLADVELTTDNVFLAFDDNVEVVSKVVDG
FT                   QEKKFIKGGRLHLYPSGMNLYRKSKGIKMPVREEMRYGDIKKVVGSEKPHYVKTLVVEQ
FT                   DDFKNTITYEQYNTKR"
     MEHEKSSNIS PSSTVRVTKM NHLVEVQHME RMNRTNHIQK LDKERYLNLK TGEIGEFKQG        60
     EVRSDSLNSL RQTFKKLRYL INTNYVGAGN ELFITLTYKE NMTDVKRLYS DFKKFMLKFR       120
     YKYEKQYGSI DYMTVVEPQE RGAWHHHLLV RFNDMTGSKM YIPNNDVAAL WGHGFTNMHS       180
     LNGVDNIGAY LSAYLADVEL TTDNVFLAFD DNVEVVSKVV DGQEKKFIKG GRLHLYPSGM       240
     NLYRKSKGIK MPVREEMRYG DIKKVVGSEK PHYVKTLVVE QDDFKNTITY EQYNTKR          297
//

If you have problems or comments...

PBIL Back to PBIL home page