(data stored in ACNUC29543 zone)

EMBL: CP001044.PE10

CP001044.PE10        Location/Qualifiers
FT   CDS             complement(7319..8647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3111"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: nha:Nham_0997 periplasmic
FT                   sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3111"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72279"
FT                   /db_xref="GOA:B2JR53"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR53"
FT                   /protein_id="ACC72279.1"
FT                   /translation="MSMPKIRSLRNQLVLALCVLVSVVGVVQGISSWQLAKAGMSALLD
FT                   LRLEQAASRLYKSGLAESLPAIPSRGSQPERDIYVTVWRDDIATPYRSTDPALALPRDA
FT                   DPGFTTAMVGGESWRIYTLREPSMVIQVAQRSRVRHELAQARSLDTLWPMIVLVPLVWI
FT                   AVLLVVRRALRRLTRLGAQVKAIDMTHFEQLSTSGVPTEIRPFITSINTMIGRLEQSIE
FT                   SERKFISDAAHELRTPLTALQLQADNLQPHIAPGNQERFRELQSGIRRSGRLIAQLLRL
FT                   ARADAALKADTLTRVDVSAVVVDAVAEVLPIALQRGIDIGADEMMGAHVYANEADIGVA
FT                   LRNLVSNAIRYTPDGGKVDLSVHVRDGMAWIEVVDSGPGIDEAQLPRVFDRFFRANTQI
FT                   EGSGLGLSIVQAIANRYGGAVTLRNRTDGQSGIVASIGFAAVP"
     MSMPKIRSLR NQLVLALCVL VSVVGVVQGI SSWQLAKAGM SALLDLRLEQ AASRLYKSGL        60
     AESLPAIPSR GSQPERDIYV TVWRDDIATP YRSTDPALAL PRDADPGFTT AMVGGESWRI       120
     YTLREPSMVI QVAQRSRVRH ELAQARSLDT LWPMIVLVPL VWIAVLLVVR RALRRLTRLG       180
     AQVKAIDMTH FEQLSTSGVP TEIRPFITSI NTMIGRLEQS IESERKFISD AAHELRTPLT       240
     ALQLQADNLQ PHIAPGNQER FRELQSGIRR SGRLIAQLLR LARADAALKA DTLTRVDVSA       300
     VVVDAVAEVL PIALQRGIDI GADEMMGAHV YANEADIGVA LRNLVSNAIR YTPDGGKVDL       360
     SVHVRDGMAW IEVVDSGPGI DEAQLPRVFD RFFRANTQIE GSGLGLSIVQ AIANRYGGAV       420
     TLRNRTDGQS GIVASIGFAA VP                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page