(data stored in ACNUC29543 zone)

EMBL: CP001044.PE100

CP001044.PE100       Location/Qualifiers
FT   CDS             complement(120298..121407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3209"
FT                   /product="protein of unknown function DUF453"
FT                   /note="PFAM: protein of unknown function DUF453; KEGG:
FT                   rpb:RPB_0878 protein of unknown function DUF453"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3209"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72369"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRP2"
FT                   /protein_id="ACC72369.1"
FT                   /translation="MQRPIPCLFMRGGTSRGPFFRAEDLPTDLSTRDRVLLDVMGSPDP
FT                   RQIDGLGGAHPLTSKVGIVRRGSRPDIDLEFLFAQLQPDADTVDTTPNCGNMLAAVVPF
FT                   ALEVGLLAPRGRQTTARVLTLNTGMSCDITVDTPEGRPEYDGSARIDGVPGTAAPVSIN
FT                   FLDTAGSVCSAMLPTGRVRDRIDLGDGRTLDVTCIDNGMPMVLVPAEALDRTGRESVAD
FT                   LNADIELKAELEALRRRCSEAMGLGDTSSKNYPKMCLVSRPVAGGALSTRCFIPHVCHD
FT                   AIGVLAAVTVATACVLDGSVAHDLASTSSGVVKQVSIEHPSGEFSVELEVDATNPHVVK
FT                   RAALLRTARLIMRGEVMVKEKAFELAETR"
     MQRPIPCLFM RGGTSRGPFF RAEDLPTDLS TRDRVLLDVM GSPDPRQIDG LGGAHPLTSK        60
     VGIVRRGSRP DIDLEFLFAQ LQPDADTVDT TPNCGNMLAA VVPFALEVGL LAPRGRQTTA       120
     RVLTLNTGMS CDITVDTPEG RPEYDGSARI DGVPGTAAPV SINFLDTAGS VCSAMLPTGR       180
     VRDRIDLGDG RTLDVTCIDN GMPMVLVPAE ALDRTGRESV ADLNADIELK AELEALRRRC       240
     SEAMGLGDTS SKNYPKMCLV SRPVAGGALS TRCFIPHVCH DAIGVLAAVT VATACVLDGS       300
     VAHDLASTSS GVVKQVSIEH PSGEFSVELE VDATNPHVVK RAALLRTARL IMRGEVMVKE       360
     KAFELAETR                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page