(data stored in ACNUC29543 zone)

EMBL: CP001044.PE101

CP001044.PE101       Location/Qualifiers
FT   CDS             121524..122444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3210"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pna:Pnap_2034 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3210"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72370"
FT                   /db_xref="GOA:B2JRP3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRP3"
FT                   /protein_id="ACC72370.1"
FT                   /translation="MELRQLEYFVHVAELGSFTRAANLLSIAQPVLSRQVRALELEFRQ
FT                   VLLERNGRGVTLTEPGRRLLEHSRSILSQVQRVHSDMEDERGEATGRLVVALPPSVSSV
FT                   LSAPLVRRFRECFPKATLCILEGLSAYALEWLTMGRADCAIVYTNSTSPSVELSPVLSE
FT                   QLYLVSSRSAPLSSEDLLAGKPVSLAEVAQKQLVMPSRPHSIRLLLEAAMAQASLKPCI
FT                   ALEIESIPAILNLVHDEELHAVLSLKAVHSDGQQQEFLVRPIEDPPLHITLWIATSAQR
FT                   PRGPLLELAIPVLRQLLCDLWRTRL"
     MELRQLEYFV HVAELGSFTR AANLLSIAQP VLSRQVRALE LEFRQVLLER NGRGVTLTEP        60
     GRRLLEHSRS ILSQVQRVHS DMEDERGEAT GRLVVALPPS VSSVLSAPLV RRFRECFPKA       120
     TLCILEGLSA YALEWLTMGR ADCAIVYTNS TSPSVELSPV LSEQLYLVSS RSAPLSSEDL       180
     LAGKPVSLAE VAQKQLVMPS RPHSIRLLLE AAMAQASLKP CIALEIESIP AILNLVHDEE       240
     LHAVLSLKAV HSDGQQQEFL VRPIEDPPLH ITLWIATSAQ RPRGPLLELA IPVLRQLLCD       300
     LWRTRL                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page