(data stored in ACNUC29543 zone)

EMBL: CP001044.PE106

CP001044.PE106       Location/Qualifiers
FT   CDS             complement(127913..129148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3215"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS00896 probable transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3215"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72375"
FT                   /db_xref="GOA:B2JRP8"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRP8"
FT                   /protein_id="ACC72375.1"
FT                   /translation="MELHGHDYWQRNLAICLFGSFSTVFAMTLILPFLPIYVEQLGVRG
FT                   HKAVVQWAGIAYGANFLAAGLIAPLWGYLGDRFGRKPMLVRASFGMALTMPLMGLSTNI
FT                   WQFVGLRLLAGIAGGYSSGATILIAVQTPRDRLAWALGLLASGVMAGNLLGPLAGGALP
FT                   SLIGIRATFWAAGGLIFIAFVATAFFVREAPLRSEATRNSGEKGWSQLPNKGVVVIMLA
FT                   TGLLLMVANMSIEPIITVYVATLVNNADGVTSVSGPNSAHVTAVAGFVMAAAALGSIVS
FT                   ASQLGKIADRVGHSTVIIMALTTAGLLLIPQAFVTKEWELVLLRFLMGLALGGLLPCIT
FT                   AVIRHNVPDNLVGTVMGYSLSAQFAGQVAGPLIGGFIGGQIGIRAVFLGTCFVLLVGAV
FT                   WNWKTIGFSRRD"
     MELHGHDYWQ RNLAICLFGS FSTVFAMTLI LPFLPIYVEQ LGVRGHKAVV QWAGIAYGAN        60
     FLAAGLIAPL WGYLGDRFGR KPMLVRASFG MALTMPLMGL STNIWQFVGL RLLAGIAGGY       120
     SSGATILIAV QTPRDRLAWA LGLLASGVMA GNLLGPLAGG ALPSLIGIRA TFWAAGGLIF       180
     IAFVATAFFV REAPLRSEAT RNSGEKGWSQ LPNKGVVVIM LATGLLLMVA NMSIEPIITV       240
     YVATLVNNAD GVTSVSGPNS AHVTAVAGFV MAAAALGSIV SASQLGKIAD RVGHSTVIIM       300
     ALTTAGLLLI PQAFVTKEWE LVLLRFLMGL ALGGLLPCIT AVIRHNVPDN LVGTVMGYSL       360
     SAQFAGQVAG PLIGGFIGGQ IGIRAVFLGT CFVLLVGAVW NWKTIGFSRR D                411
//

If you have problems or comments...

PBIL Back to PBIL home page