(data stored in ACNUC29543 zone)

EMBL: CP001044.PE11

CP001044.PE11        Location/Qualifiers
FT   CDS             complement(8881..9189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3112"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3112"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72280"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR54"
FT                   /protein_id="ACC72280.1"
FT                   /translation="MKTLIRTAAAAIALALPIATFAQSNAPVTRAGVLAQVVQPDSAGD
FT                   DPAGGNAHYPAAIEAAQARIDARQTDEYGGVTGGTSQAGAPFHPQYDAGLKSIYVGH"
     MKTLIRTAAA AIALALPIAT FAQSNAPVTR AGVLAQVVQP DSAGDDPAGG NAHYPAAIEA        60
     AQARIDARQT DEYGGVTGGT SQAGAPFHPQ YDAGLKSIYV GH                          102
//

If you have problems or comments...

PBIL Back to PBIL home page