(data stored in ACNUC29543 zone)

EMBL: CP001044.PE110

CP001044.PE110       Location/Qualifiers
FT   CDS             complement(131394..132350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3219"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bra:BRADO6501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3219"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72379"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRQ2"
FT                   /protein_id="ACC72379.1"
FT                   /translation="MSFEEVAGWGEDTWERDVTGVAVDSQDRVYVLRRGADAVTVMSPD
FT                   GAVLNRWGGGCFSPRPHLISIGEDDTVYVADDGGHQVFVFDRTGRLLDTIGTGTPSDTG
FT                   YDAKASSAEIAYDGMVGGPPFNRPTKVAPWRNGELFVSDGYRNCRVHRFSADRQLILSW
FT                   GGPGAGDGCFVIPHSVTVDAEGRVLVCDRENDRIQIFSCDGELLDVWNNVQRPTDVAFD
FT                   RHGNAYVTELPRGPADIKSWRLGRAAQELPGRVTIRSSEGSIIGQLHCPGLEFPAPHAV
FT                   AVDSKGAVYVSEVPESFAGYTGRPYSLHRCLRKFEPR"
     MSFEEVAGWG EDTWERDVTG VAVDSQDRVY VLRRGADAVT VMSPDGAVLN RWGGGCFSPR        60
     PHLISIGEDD TVYVADDGGH QVFVFDRTGR LLDTIGTGTP SDTGYDAKAS SAEIAYDGMV       120
     GGPPFNRPTK VAPWRNGELF VSDGYRNCRV HRFSADRQLI LSWGGPGAGD GCFVIPHSVT       180
     VDAEGRVLVC DRENDRIQIF SCDGELLDVW NNVQRPTDVA FDRHGNAYVT ELPRGPADIK       240
     SWRLGRAAQE LPGRVTIRSS EGSIIGQLHC PGLEFPAPHA VAVDSKGAVY VSEVPESFAG       300
     YTGRPYSLHR CLRKFEPR                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page