(data stored in ACNUC29543 zone)

EMBL: CP001044.PE115

CP001044.PE115       Location/Qualifiers
FT   CDS             complement(135815..136975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3224"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: rha:RHA1_ro10289
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3224"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72384"
FT                   /db_xref="GOA:B2JRQ7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRQ7"
FT                   /protein_id="ACC72384.1"
FT                   /translation="MTTATLERPEVRDNQLEHVDIKVIDTDVHVEPRSFEELIPYLEAP
FT                   WRDVPNLIASVPFSRPTYRTLEGGGRKDAYPKVGDIGSDPDMVGQQMFVDDPTDYAILL
FT                   PWSFRGFTVDPRLDTALASAVNAWLADTWLSKYNAENRYVGSISIGIDDPMAAAKEIDK
FT                   WGEHPGFRQVVIGHYGPRPFGHPIYDPIWEAAARHNLPIAMHFRGGATQPLGWTSTGPL
FT                   QYFVEYHSLIAPMAYGAHLASWICNGVFDRHPEMKVLFIEGGFLWYQPFIDRLERHWKR
FT                   TGQELGLKKTPHQYVRDHIRFATQPIEENTDPHKIATLYEEANARELVMFSSDYPHYDY
FT                   DPPSKALPRSLDAEMKTRIMYENARVIYDLPKTRPVDRFDLAGGAR"
     MTTATLERPE VRDNQLEHVD IKVIDTDVHV EPRSFEELIP YLEAPWRDVP NLIASVPFSR        60
     PTYRTLEGGG RKDAYPKVGD IGSDPDMVGQ QMFVDDPTDY AILLPWSFRG FTVDPRLDTA       120
     LASAVNAWLA DTWLSKYNAE NRYVGSISIG IDDPMAAAKE IDKWGEHPGF RQVVIGHYGP       180
     RPFGHPIYDP IWEAAARHNL PIAMHFRGGA TQPLGWTSTG PLQYFVEYHS LIAPMAYGAH       240
     LASWICNGVF DRHPEMKVLF IEGGFLWYQP FIDRLERHWK RTGQELGLKK TPHQYVRDHI       300
     RFATQPIEEN TDPHKIATLY EEANARELVM FSSDYPHYDY DPPSKALPRS LDAEMKTRIM       360
     YENARVIYDL PKTRPVDRFD LAGGAR                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page