(data stored in ACNUC29543 zone)

EMBL: CP001044.PE12

CP001044.PE12        Location/Qualifiers
FT   CDS             9287..9535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3113"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72281"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR55"
FT                   /protein_id="ACC72281.1"
FT                   /translation="MPRVNGWPLMRLPPFQGGRLVQQLDLAFRIANERALHVVAPFEST
FT                   FQRARESAQQSHFPLIQPAYDAFRRCIVPDLRRPKDT"
     MPRVNGWPLM RLPPFQGGRL VQQLDLAFRI ANERALHVVA PFESTFQRAR ESAQQSHFPL        60
     IQPAYDAFRR CIVPDLRRPK DT                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page