(data stored in ACNUC29543 zone)

EMBL: CP001044.PE120

CP001044.PE120       Location/Qualifiers
FT   CDS             complement(148252..149355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3230"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   rme:Rmet_4228 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3230"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72389"
FT                   /db_xref="GOA:B2JRR2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRR2"
FT                   /protein_id="ACC72389.1"
FT                   /translation="MRGVDTFTENLFSVRKLDDFVPTSHPLRSIRVMANEALAKMDRIF
FT                   AGMYEADIKGGRPSIAPEKLLRAMLLQVLYSIRSERQLMEQTQYNLLFRWFIGLSMDDS
FT                   VWVPTVFTKNRERLIRHDAVVEFFNEVLSIAQKKNWLSGEHFSVDGTLIHAWAGHKSFV
FT                   RKDGEEDRDNDGGSGEGGFKGSKRSNETHESKTDPDARLYRKGKTASELRYMGHTLTDN
FT                   RHGLVVNARVSRADGHAEREAAKVMINDARQAANDAAAQITLGADKGYDAQEFIEACQQ
FT                   MKVTPHVAQNTSGRRSAVPDAIARSVGYAISQQKRKLIEQGFGWAKTVGRMRQVMVRGL
FT                   KKVDQMFVLNMAAYNLVRMRSLGQARP"
     MRGVDTFTEN LFSVRKLDDF VPTSHPLRSI RVMANEALAK MDRIFAGMYE ADIKGGRPSI        60
     APEKLLRAML LQVLYSIRSE RQLMEQTQYN LLFRWFIGLS MDDSVWVPTV FTKNRERLIR       120
     HDAVVEFFNE VLSIAQKKNW LSGEHFSVDG TLIHAWAGHK SFVRKDGEED RDNDGGSGEG       180
     GFKGSKRSNE THESKTDPDA RLYRKGKTAS ELRYMGHTLT DNRHGLVVNA RVSRADGHAE       240
     REAAKVMIND ARQAANDAAA QITLGADKGY DAQEFIEACQ QMKVTPHVAQ NTSGRRSAVP       300
     DAIARSVGYA ISQQKRKLIE QGFGWAKTVG RMRQVMVRGL KKVDQMFVLN MAAYNLVRMR       360
     SLGQARP                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page