(data stored in ACNUC29543 zone)

EMBL: CP001044.PE122

CP001044.PE122       Location/Qualifiers
FT   CDS             complement(151122..152426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3232"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: dar:Daro_2336
FT                   phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3232"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72391"
FT                   /db_xref="GOA:B2JRR4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRR4"
FT                   /protein_id="ACC72391.1"
FT                   /translation="MLTDLELRALKPTGRIYKVTDQRGLYVAVTSSGAVSFRFDYRLNG
FT                   RRETLVIGRYDPGLPARGARAADELTFGMSMRLAEARLLLERARRQVEQGVSPSKSKVE
FT                   KRVEAADAMTFGKWVEKYFAEATLAESTRAMRKSVYDRNLAAEFGRLTLEEITPSRLLM
FT                   RCEKIKERGAAAPAVQARDIVLQVYRFVQARGLRVANPAEDIRPSAIATFKPRDRALTP
FT                   GEIHMFFKALERTPTLPTLRLAVKFMLLTMVRKSEFILATWDEVDFNAAIWTIPKDRMK
FT                   GGRPHNVYLSQQALDILVTFKTCFGASSYLHPGRYESELPISAATLNRVIDSAVRLIRE
FT                   SGAPDFESFSVHDLRRTASTQLHEAGFNSDWIEKCLAHEQRGVRAVYNKAEYAEQRRGM
FT                   LQTWAEMLDGWIMKDHEIDNGPRVRPTQSPLTSIA"
     MLTDLELRAL KPTGRIYKVT DQRGLYVAVT SSGAVSFRFD YRLNGRRETL VIGRYDPGLP        60
     ARGARAADEL TFGMSMRLAE ARLLLERARR QVEQGVSPSK SKVEKRVEAA DAMTFGKWVE       120
     KYFAEATLAE STRAMRKSVY DRNLAAEFGR LTLEEITPSR LLMRCEKIKE RGAAAPAVQA       180
     RDIVLQVYRF VQARGLRVAN PAEDIRPSAI ATFKPRDRAL TPGEIHMFFK ALERTPTLPT       240
     LRLAVKFMLL TMVRKSEFIL ATWDEVDFNA AIWTIPKDRM KGGRPHNVYL SQQALDILVT       300
     FKTCFGASSY LHPGRYESEL PISAATLNRV IDSAVRLIRE SGAPDFESFS VHDLRRTAST       360
     QLHEAGFNSD WIEKCLAHEQ RGVRAVYNKA EYAEQRRGML QTWAEMLDGW IMKDHEIDNG       420
     PRVRPTQSPL TSIA                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page