(data stored in ACNUC29543 zone)

EMBL: CP001044.PE123

CP001044.PE123       Location/Qualifiers
FT   CDS             complement(153284..153865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3233"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bja:blr6905
FT                   probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3233"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72392"
FT                   /db_xref="GOA:B2JS15"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS15"
FT                   /protein_id="ACC72392.1"
FT                   /translation="MRFEKGHKAVTRQHILEVASKCFRREGVSAAGISGIMGEAGLTNG
FT                   AFYLHFESKEALVREAVGSALAERQQNLEEKVQAGVDLEGVIRSYLNQAHCEDPACGCP
FT                   SAALLPEIARQSVPTRQTYEDGLQSFVSTLAALLPEADSAAAGRRATAIFALMVGTLQF
FT                   ARAVPDVARAEQILEGGVEAALLLARASPV"
     MRFEKGHKAV TRQHILEVAS KCFRREGVSA AGISGIMGEA GLTNGAFYLH FESKEALVRE        60
     AVGSALAERQ QNLEEKVQAG VDLEGVIRSY LNQAHCEDPA CGCPSAALLP EIARQSVPTR       120
     QTYEDGLQSF VSTLAALLPE ADSAAAGRRA TAIFALMVGT LQFARAVPDV ARAEQILEGG       180
     VEAALLLARA SPV                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page