(data stored in ACNUC29543 zone)

EMBL: CP001044.PE128

CP001044.PE128       Location/Qualifiers
FT   CDS             complement(159818..161092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3239"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   bur:Bcep18194_B1028 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3239"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72397"
FT                   /db_xref="GOA:B2JS20"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS20"
FT                   /protein_id="ACC72397.1"
FT                   /translation="MRFDARAAAKLPSGAHMTFEGFPGLRLQASTSRKSWTYRYKSPVD
FT                   SRMRQVKLGEWPAMSFAGAIAAWEKSRVERDSGAELSALRRKPETGTTRPSPDTYSVRQ
FT                   LCRDYLQGYVEVNRKTKGAVEVARIFKAMLGPIADMRAASITRAQAFDLLESYRSTPML
FT                   AARLRMELGGAWHYALDAGRLPENTANWWKEVLRGRLKSKGRKVEGQYTGTQKRVLSVD
FT                   ELGTLIRWLPNFSLTVADALTLYLWTGTRGGEIVAMESTEIADESDGLWWTIPKRKTKG
FT                   LHNEKATDLRVPLVGRAEVIVRRRLDQAKGTVLFPSSRGEAMDQTVVQHGVYYHQPYCK
FT                   IAPNHDRPRLPVTHWSAHDLRRTTRTLLAALGCPNEIAEAVLGHVLPGIIGVYNRHTYD
FT                   RERRQWLTQLSHRLEDIAATYPPKK"
     MRFDARAAAK LPSGAHMTFE GFPGLRLQAS TSRKSWTYRY KSPVDSRMRQ VKLGEWPAMS        60
     FAGAIAAWEK SRVERDSGAE LSALRRKPET GTTRPSPDTY SVRQLCRDYL QGYVEVNRKT       120
     KGAVEVARIF KAMLGPIADM RAASITRAQA FDLLESYRST PMLAARLRME LGGAWHYALD       180
     AGRLPENTAN WWKEVLRGRL KSKGRKVEGQ YTGTQKRVLS VDELGTLIRW LPNFSLTVAD       240
     ALTLYLWTGT RGGEIVAMES TEIADESDGL WWTIPKRKTK GLHNEKATDL RVPLVGRAEV       300
     IVRRRLDQAK GTVLFPSSRG EAMDQTVVQH GVYYHQPYCK IAPNHDRPRL PVTHWSAHDL       360
     RRTTRTLLAA LGCPNEIAEA VLGHVLPGII GVYNRHTYDR ERRQWLTQLS HRLEDIAATY       420
     PPKK                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page