(data stored in ACNUC29543 zone)

EMBL: CP001044.PE131

CP001044.PE131       Location/Qualifiers
FT   CDS             complement(162993..163319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3242"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3242"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72400"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS23"
FT                   /protein_id="ACC72400.1"
FT                   /translation="MKSLIKAVALAAVLAVPAVSFAQSNQPVTRAQVRAELVQLEKAGY
FT                   NPATAVDSTYPADIQAAESRVSAQNGAVAQAPVADTGYGSSTNGSSQAGAKSLNPAQDV
FT                   YFGH"
     MKSLIKAVAL AAVLAVPAVS FAQSNQPVTR AQVRAELVQL EKAGYNPATA VDSTYPADIQ        60
     AAESRVSAQN GAVAQAPVAD TGYGSSTNGS SQAGAKSLNP AQDVYFGH                    108
//

If you have problems or comments...

PBIL Back to PBIL home page