(data stored in ACNUC29543 zone)

EMBL: CP001044.PE137

CP001044.PE137       Location/Qualifiers
FT   CDS             168221..168967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3248"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bxe:Bxe_B1687 ABC
FT                   polar amino acid family transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3248"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72406"
FT                   /db_xref="GOA:B2JS29"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS29"
FT                   /protein_id="ACC72406.1"
FT                   /translation="MSYTFDFSSFDLYAGMLVRGVGVTLGLTAISTVLGGLVGMAGAVV
FT                   AASGPKWARWLIAGYVEAIRNTPFLVQLFFVFFGLPSLGIHIDEIQAAILAMTVNLGAY
FT                   AIEIVRAGIDSIPRGQVQAAQALGLQGRQVFRHVVLPQAIANVFPALLSQVLIVMLGSA
FT                   VVSQISVPDLTYAANYIQSRNFRSFEAYVIITATYLALSIVLRQLLNRLGKGLFAGRAA
FT                   RSTDASPRRVFSLRGARAASTTERSS"
     MSYTFDFSSF DLYAGMLVRG VGVTLGLTAI STVLGGLVGM AGAVVAASGP KWARWLIAGY        60
     VEAIRNTPFL VQLFFVFFGL PSLGIHIDEI QAAILAMTVN LGAYAIEIVR AGIDSIPRGQ       120
     VQAAQALGLQ GRQVFRHVVL PQAIANVFPA LLSQVLIVML GSAVVSQISV PDLTYAANYI       180
     QSRNFRSFEA YVIITATYLA LSIVLRQLLN RLGKGLFAGR AARSTDASPR RVFSLRGARA       240
     ASTTERSS                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page