(data stored in ACNUC29543 zone)

EMBL: CP001044.PE138

CP001044.PE138       Location/Qualifiers
FT   CDS             168964..169620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3249"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bxe:Bxe_B1688 ABC
FT                   polar amino acid family transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3249"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72407"
FT                   /db_xref="GOA:B2JS30"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS30"
FT                   /protein_id="ACC72407.1"
FT                   /translation="MIEFTLWDIARNLLLAARWTVLLSLIAFVGGGVVGLLLLAMRVSP
FT                   FPWLRRIVVLYVELFQGTPLLMQLFLAFFGLPLMGVDVSPWVAATVTLTLYTSAYLVDI
FT                   WRGCVEAVPRGQWAAGASLGMTFAQQLRYVVWPQALKIAVAPTVGFLVQVVKSTALTSI
FT                   IGFTELTKTGTMITNAAFRPFPIYGMVAVLYFAMCFPLTWWARLLERKQKATQQR"
     MIEFTLWDIA RNLLLAARWT VLLSLIAFVG GGVVGLLLLA MRVSPFPWLR RIVVLYVELF        60
     QGTPLLMQLF LAFFGLPLMG VDVSPWVAAT VTLTLYTSAY LVDIWRGCVE AVPRGQWAAG       120
     ASLGMTFAQQ LRYVVWPQAL KIAVAPTVGF LVQVVKSTAL TSIIGFTELT KTGTMITNAA       180
     FRPFPIYGMV AVLYFAMCFP LTWWARLLER KQKATQQR                               218
//

If you have problems or comments...

PBIL Back to PBIL home page