(data stored in ACNUC29543 zone)

EMBL: CP001044.PE142

CP001044.PE142       Location/Qualifiers
FT   CDS             complement(174462..179090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3253"
FT                   /product="cellulose synthase operon C domain protein"
FT                   /note="PFAM: TPR repeat-containing protein; cellulose
FT                   synthase operon C domain protein; Tetratricopeptide TPR_2
FT                   repeat protein; SMART: Tetratricopeptide domain protein;
FT                   KEGG: bxe:Bxe_B2043 putative cellulose synthase operon
FT                   protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3253"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72411"
FT                   /db_xref="GOA:B2JS34"
FT                   /db_xref="InterPro:IPR003921"
FT                   /db_xref="InterPro:IPR008410"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS34"
FT                   /protein_id="ACC72411.1"
FT                   /translation="MPIRQRALVIGIALTLGAGAAASAFAQGQPNDPMNVLIDQGKYWQ
FT                   AHQRGDLAEQAWLKVLRIDPKQPDALYGMGIVMSDRKDGAGAQQYLARLRQAAPNYPNM
FT                   DELARRLGQSSPTDQAVNDARRLAQSGQQASAAQAYRQALGTKPANPQLALEYYQALGS
FT                   SPQGWEEARRGLEQLAREHRDDPRFALAYARHLTYREANRREGIEQLAQLSKDSIVGAQ
FT                   AKAAWRQALLWLGVRASDAPLFQAYLSVAPDDAAVKARADSISEQDRRASERAQQNAGA
FT                   DARGRTVAEGFAALDRGDLVTAKARFSSVLASSPNDGDALGGMGVALLKQEQFAQAREY
FT                   LLRASQQGGAARWREALNSATYWMYTSEGLGEQSNGNLAHAKALFEKAIAVSPGDVTAQ
FT                   TALGDLLMQSGDPRGAEAAFRMALRRQADNPDAIRGLVGALAAQGRGDDALSFANQLTE
FT                   AQRKKVGGADRLRGEAQAAQARAAEARGDLGNARSLFEDALLSNPDDPWLRLDLARIYA
FT                   KQGAYANAKSIMDGLIALHPDMPDAFYASALLAADMQDWRYGLSQLERIPVNKRTDAMA
FT                   LLQHRLWVHQQCDEAVALAKSGRVAQARGVLNNAEPVAGNHAELIGAIASAYVNTGDTA
FT                   RALMMVRGAVARSPNDAGLLLTDAGILLNAGQDAELGEVMRRLASMQLTGQQRSDFEKI
FT                   NVAIVVRRTDALRQANDLASAFDVLSPWLAARPNDPDILAALARLYTANNDNANALATY
FT                   RLALAQNPNDLGLLLNAAGAATQIRKFDFAESSLRHALRIAPNNADALAAMGRMYRAQG
FT                   RNSLAAQYFQRALIAQNAPLARQGTQPAGVNGTPVPSGWDVPLPPRGPIPLPGTNPFAN
FT                   RTSADASNSVPFPAQNTQPYLMPMPAYTPPTQPAPYIAPQTQPASQIDSLGVLAPQAAS
FT                   NGREAPDVDGYGPDQYGSSQSGGGLAPGQAYPGQGYAQPQSYQQPYPQQAYQQPVYVQP
FT                   NDAAVSTPWPMSPQAQAAAQAQATQGMNQQPTSASKKRAAKNARATNSSAASAQQQGYA
FT                   QPYPQQQAYPPPYPQQPAYAQQPYPQQRAYAQQAYPQQGYQPQPYQQQAYPQQAYPQNY
FT                   TNQGYGLVPYIPQPPAPYPARNAQLQDEQNRQYRQPAQPQPLTVEEELAQINREQTSTV
FT                   SGGIVFRNRDGENGLSNLTDIEAPVQGRIRAGDGHVIVEVTPVTLDAGTASNNTNTLAR
FT                   FGSSQAFGTSTVLPGSQTASGVGADVGYEWRGLKADVGATPWGFREQNIVGGVQYRGNI
FT                   TDKVSYKLTAGRRGVTDSLLSYAGAHDSAMNLQWGGVTSNGLRGDAGWDDGTNGLYVNA
FT                   SWAYLMGHNVASNNAVKGGGGVYTRLVKDTDQTLTVGVNTTLMHYDKNLSYFTFGQGGY
FT                   FSPQQYAILNLPIEYTGRNGPFTYDLKASIGVQHYRQDESDYFPTNSTYQSKAASASNV
FT                   PDPGAVYPSQSKTGVSYSIDAVGEYQLAPQLAVGAAASFGNAYQYREFVAAVYVRYAFT
FT                   KQSGSSTFPPSPVRSYYLPVNE"
     MPIRQRALVI GIALTLGAGA AASAFAQGQP NDPMNVLIDQ GKYWQAHQRG DLAEQAWLKV        60
     LRIDPKQPDA LYGMGIVMSD RKDGAGAQQY LARLRQAAPN YPNMDELARR LGQSSPTDQA       120
     VNDARRLAQS GQQASAAQAY RQALGTKPAN PQLALEYYQA LGSSPQGWEE ARRGLEQLAR       180
     EHRDDPRFAL AYARHLTYRE ANRREGIEQL AQLSKDSIVG AQAKAAWRQA LLWLGVRASD       240
     APLFQAYLSV APDDAAVKAR ADSISEQDRR ASERAQQNAG ADARGRTVAE GFAALDRGDL       300
     VTAKARFSSV LASSPNDGDA LGGMGVALLK QEQFAQAREY LLRASQQGGA ARWREALNSA       360
     TYWMYTSEGL GEQSNGNLAH AKALFEKAIA VSPGDVTAQT ALGDLLMQSG DPRGAEAAFR       420
     MALRRQADNP DAIRGLVGAL AAQGRGDDAL SFANQLTEAQ RKKVGGADRL RGEAQAAQAR       480
     AAEARGDLGN ARSLFEDALL SNPDDPWLRL DLARIYAKQG AYANAKSIMD GLIALHPDMP       540
     DAFYASALLA ADMQDWRYGL SQLERIPVNK RTDAMALLQH RLWVHQQCDE AVALAKSGRV       600
     AQARGVLNNA EPVAGNHAEL IGAIASAYVN TGDTARALMM VRGAVARSPN DAGLLLTDAG       660
     ILLNAGQDAE LGEVMRRLAS MQLTGQQRSD FEKINVAIVV RRTDALRQAN DLASAFDVLS       720
     PWLAARPNDP DILAALARLY TANNDNANAL ATYRLALAQN PNDLGLLLNA AGAATQIRKF       780
     DFAESSLRHA LRIAPNNADA LAAMGRMYRA QGRNSLAAQY FQRALIAQNA PLARQGTQPA       840
     GVNGTPVPSG WDVPLPPRGP IPLPGTNPFA NRTSADASNS VPFPAQNTQP YLMPMPAYTP       900
     PTQPAPYIAP QTQPASQIDS LGVLAPQAAS NGREAPDVDG YGPDQYGSSQ SGGGLAPGQA       960
     YPGQGYAQPQ SYQQPYPQQA YQQPVYVQPN DAAVSTPWPM SPQAQAAAQA QATQGMNQQP      1020
     TSASKKRAAK NARATNSSAA SAQQQGYAQP YPQQQAYPPP YPQQPAYAQQ PYPQQRAYAQ      1080
     QAYPQQGYQP QPYQQQAYPQ QAYPQNYTNQ GYGLVPYIPQ PPAPYPARNA QLQDEQNRQY      1140
     RQPAQPQPLT VEEELAQINR EQTSTVSGGI VFRNRDGENG LSNLTDIEAP VQGRIRAGDG      1200
     HVIVEVTPVT LDAGTASNNT NTLARFGSSQ AFGTSTVLPG SQTASGVGAD VGYEWRGLKA      1260
     DVGATPWGFR EQNIVGGVQY RGNITDKVSY KLTAGRRGVT DSLLSYAGAH DSAMNLQWGG      1320
     VTSNGLRGDA GWDDGTNGLY VNASWAYLMG HNVASNNAVK GGGGVYTRLV KDTDQTLTVG      1380
     VNTTLMHYDK NLSYFTFGQG GYFSPQQYAI LNLPIEYTGR NGPFTYDLKA SIGVQHYRQD      1440
     ESDYFPTNST YQSKAASASN VPDPGAVYPS QSKTGVSYSI DAVGEYQLAP QLAVGAAASF      1500
     GNAYQYREFV AAVYVRYAFT KQSGSSTFPP SPVRSYYLPV NE                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page