(data stored in ACNUC29543 zone)

EMBL: CP001044.PE144

CP001044.PE144       Location/Qualifiers
FT   CDS             complement(180297..182861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3255"
FT                   /product="cellulose synthase subunit B"
FT                   /note="PFAM: cellulose synthase subunit B; KEGG:
FT                   bxe:Bxe_B2041 cellulose synthase regulatory subunit, cyclic
FT                   di-GMP binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3255"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72413"
FT                   /db_xref="GOA:B2JS36"
FT                   /db_xref="InterPro:IPR003920"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS36"
FT                   /protein_id="ACC72413.1"
FT                   /translation="MRILRYDAAVAAAMRTGVRLLACSACRLPLRATVGALLFAATLPA
FT                   VQAASASPPGASPGAVPATKAQLAATPGTTPANQPLVAQSTAPAPAGNGLPPLPSAKPV
FT                   DARAAQQPSFAEPAPQTFAAVRSGRDTMPTTADNGTAVSGGRRQTFTFAQLGALDPLQL
FT                   RGVDGQNGVPFSVRADEVVTGANLHLIYSYSPSLLSNLSHLKVLVNGEVAATLPLPREQ
FT                   AGTLLARDIPLEPRLVTEFNHLNIQLIGHYTQGCEDPASSALWATVSNASTLDLTFASL
FT                   ATKPDLGALPLPFFDRRDVRRLELPFVFAAKPSSQALEAAGAVASWFGSLAGYRGALFP
FT                   AQLDNAPLSGNAVVFATNDERPAGVTLPAINGPVLAIVDREAPARGKLLLVMGRDAREL
FT                   KIAANALSLGEAALSGTMQTITHVDAPRARQPYDAPGWLPTDRAVRFGELTVPKDLSVR
FT                   GYNPDVVRVDLRIAPDLFTWRTKGVPVDLRYRYTVRPAPDRSTLNISVNNNFVQALRIP
FT                   AESSSMLDLGRYLNRMLPDHTAPASKEIFIPPHLLASQAQLRFHFYYDMPKTGECQGQV
FT                   LDNVRGEIDPDSTIDLSSFPHYMALPDLAAFANSGWPFTKLADLSQTAVILPANANPSD
FT                   YSLYLMVMGRMGASTAYPVTGVTVATAGDVQRLADKDLLVIGAPGQQPLLSAWEKDMPF
FT                   SAADDTRRMQFSNVSFRIANWWHGNRGGVRTAGRADLSLVNSSGDAIVTGFRSPLEKGR
FT                   SVVALISAPGQSEADLTNAMLDPDLVQSIQGGLTVVRGRTLEVVSNGDVYYVGHLSPVE
FT                   YMRWALSVHPLLLVSGGLLAALIIAAVFYRLLRAVAARRLKD"
     MRILRYDAAV AAAMRTGVRL LACSACRLPL RATVGALLFA ATLPAVQAAS ASPPGASPGA        60
     VPATKAQLAA TPGTTPANQP LVAQSTAPAP AGNGLPPLPS AKPVDARAAQ QPSFAEPAPQ       120
     TFAAVRSGRD TMPTTADNGT AVSGGRRQTF TFAQLGALDP LQLRGVDGQN GVPFSVRADE       180
     VVTGANLHLI YSYSPSLLSN LSHLKVLVNG EVAATLPLPR EQAGTLLARD IPLEPRLVTE       240
     FNHLNIQLIG HYTQGCEDPA SSALWATVSN ASTLDLTFAS LATKPDLGAL PLPFFDRRDV       300
     RRLELPFVFA AKPSSQALEA AGAVASWFGS LAGYRGALFP AQLDNAPLSG NAVVFATNDE       360
     RPAGVTLPAI NGPVLAIVDR EAPARGKLLL VMGRDARELK IAANALSLGE AALSGTMQTI       420
     THVDAPRARQ PYDAPGWLPT DRAVRFGELT VPKDLSVRGY NPDVVRVDLR IAPDLFTWRT       480
     KGVPVDLRYR YTVRPAPDRS TLNISVNNNF VQALRIPAES SSMLDLGRYL NRMLPDHTAP       540
     ASKEIFIPPH LLASQAQLRF HFYYDMPKTG ECQGQVLDNV RGEIDPDSTI DLSSFPHYMA       600
     LPDLAAFANS GWPFTKLADL SQTAVILPAN ANPSDYSLYL MVMGRMGAST AYPVTGVTVA       660
     TAGDVQRLAD KDLLVIGAPG QQPLLSAWEK DMPFSAADDT RRMQFSNVSF RIANWWHGNR       720
     GGVRTAGRAD LSLVNSSGDA IVTGFRSPLE KGRSVVALIS APGQSEADLT NAMLDPDLVQ       780
     SIQGGLTVVR GRTLEVVSNG DVYYVGHLSP VEYMRWALSV HPLLLVSGGL LAALIIAAVF       840
     YRLLRAVAAR RLKD                                                         854
//

If you have problems or comments...

PBIL Back to PBIL home page