(data stored in ACNUC29543 zone)

EMBL: CP001044.PE145

CP001044.PE145       Location/Qualifiers
FT   CDS             complement(182865..185096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3256"
FT                   /product="cellulose synthase catalytic subunit
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.12"
FT                   /note="KEGG: bxe:Bxe_B2040 cellulose synthase
FT                   (UDP-forming); TIGRFAM: cellulose synthase catalytic
FT                   subunit (UDP-forming); PFAM: glycosyl transferase family 2;
FT                   type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3256"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72414"
FT                   /db_xref="GOA:B2JS37"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR003919"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS37"
FT                   /protein_id="ACC72414.1"
FT                   /translation="MSTAPEDILDAVDAEPPRRSRFDRLASHLIDGRILGSKPVTILLV
FT                   LFALASLFFVFTVPLAFGEQLTFALCCFVCAMLFRRAKGHYATLVMIMLSVIATGRYMY
FT                   WRLTETTYWERPLDAAWGLLLVSAEVYAALVLMLGYFQTAWPLKRKPLPLPADRSEWPT
FT                   VDIFIPTYNEPLSVVKPTVYAAIALDYPKDKLSIHVLDDGRRPEFKAFCEEVGVAWTIR
FT                   SHNRHAKAGNINEALKITDGEYFAIFDCDHIPTRSFLQVGLGWFLRDKKLSMLQTPHHF
FT                   FSADPFEKNLGTFRKVPNEGELFYGLVQDGNDLWNATFFCGSCALLRRTMVEEIGGIAI
FT                   ETVTEDAHTALKLHRRGYTTAYLAIPQAAGLATESLGGHIGQRIRWARGMTQIFRIDNP
FT                   LTGRGLTFGQRLCYLNAMMHFFYGIPRLVFLTAPLSFLFFNAHIIQAAAGTIAIFALPH
FT                   MFHANVTNSRMQQKFRHSFWSEVYESVLASYITAPTLLALINPKLGKFNVTAKGGRIEE
FT                   QYFDWAISRPYLILLALNLIGFIVGCVHIALNASLHSEVQTTVLNLAWTGYNMLILGAS
FT                   VAAAREQRQVRATHRVAMRIPASLRFSTGRTLTCETVDYAEGGLALQLPAAIQVPLHEQ
FT                   VVVSLFRGQDEFVFPADVTYAVPGRVGLKFGAMTREQELDFVQSTFARADAWTGWAEGR
FT                   EVDTPLKSFSHVMRVGVGGIGGLFEHLYADLRTLRSRRKAAANDTKNGK"
     MSTAPEDILD AVDAEPPRRS RFDRLASHLI DGRILGSKPV TILLVLFALA SLFFVFTVPL        60
     AFGEQLTFAL CCFVCAMLFR RAKGHYATLV MIMLSVIATG RYMYWRLTET TYWERPLDAA       120
     WGLLLVSAEV YAALVLMLGY FQTAWPLKRK PLPLPADRSE WPTVDIFIPT YNEPLSVVKP       180
     TVYAAIALDY PKDKLSIHVL DDGRRPEFKA FCEEVGVAWT IRSHNRHAKA GNINEALKIT       240
     DGEYFAIFDC DHIPTRSFLQ VGLGWFLRDK KLSMLQTPHH FFSADPFEKN LGTFRKVPNE       300
     GELFYGLVQD GNDLWNATFF CGSCALLRRT MVEEIGGIAI ETVTEDAHTA LKLHRRGYTT       360
     AYLAIPQAAG LATESLGGHI GQRIRWARGM TQIFRIDNPL TGRGLTFGQR LCYLNAMMHF       420
     FYGIPRLVFL TAPLSFLFFN AHIIQAAAGT IAIFALPHMF HANVTNSRMQ QKFRHSFWSE       480
     VYESVLASYI TAPTLLALIN PKLGKFNVTA KGGRIEEQYF DWAISRPYLI LLALNLIGFI       540
     VGCVHIALNA SLHSEVQTTV LNLAWTGYNM LILGASVAAA REQRQVRATH RVAMRIPASL       600
     RFSTGRTLTC ETVDYAEGGL ALQLPAAIQV PLHEQVVVSL FRGQDEFVFP ADVTYAVPGR       660
     VGLKFGAMTR EQELDFVQST FARADAWTGW AEGREVDTPL KSFSHVMRVG VGGIGGLFEH       720
     LYADLRTLRS RRKAAANDTK NGK                                               743
//

If you have problems or comments...

PBIL Back to PBIL home page