(data stored in ACNUC29543 zone)

EMBL: CP001044.PE153

CP001044.PE153       Location/Qualifiers
FT   CDS             complement(190913..191668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3264"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein GntR HTH; regulatory
FT                   protein DeoR; Helix-turn-helix type 11 domain protein;
FT                   KEGG: spe:Spro_2259 transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3264"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72422"
FT                   /db_xref="GOA:B2JS45"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS45"
FT                   /protein_id="ACC72422.1"
FT                   /translation="MLTSQRKKLILDALKRDGQVLAKALSDTFGVSEDTVRRDLRELAA
FT                   EGKLQRVHGGALAASPAVANLAGRRAIGSKAKAAIGRAAAQMIAPGQIAFVDGGTTAIQ
FT                   LVRHLPIDLRATIVTHSPSVAVELAEHEALEVIVIGGRLFRHSMVTVGAAAIEALGHIR
FT                   ADLYFMGVTGVHREAGLSTGDLEEAYVKRALVARAAETVVLASSEKLNAASAYMIAGID
FT                   AASAILVEKDTPESTTAPFEASGVTILRA"
     MLTSQRKKLI LDALKRDGQV LAKALSDTFG VSEDTVRRDL RELAAEGKLQ RVHGGALAAS        60
     PAVANLAGRR AIGSKAKAAI GRAAAQMIAP GQIAFVDGGT TAIQLVRHLP IDLRATIVTH       120
     SPSVAVELAE HEALEVIVIG GRLFRHSMVT VGAAAIEALG HIRADLYFMG VTGVHREAGL       180
     STGDLEEAYV KRALVARAAE TVVLASSEKL NAASAYMIAG IDAASAILVE KDTPESTTAP       240
     FEASGVTILR A                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page