(data stored in ACNUC29543 zone)

EMBL: CP001044.PE159

CP001044.PE159       Location/Qualifiers
FT   CDS             complement(197055..198257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3272"
FT                   /product="Capsule polysaccharide biosynthesis protein"
FT                   /note="PFAM: Capsule polysaccharide biosynthesis protein;
FT                   KEGG: bps:BPSL2776 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3272"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72428"
FT                   /db_xref="GOA:B2JS51"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS51"
FT                   /protein_id="ACC72428.1"
FT                   /translation="MTIAVVIDSLERFYFVRRLVKALDKEGDFVFMTSEPLAHLFFRLE
FT                   GRHSIYLRRAKNNSSGLAYGSSLFDRSIEVMNGTIDAHVARQDWMATFTAALDVFNRLA
FT                   ITVCVMWNGQQLICRAVGHACSTYGVRVRFLELSNLPEKLFADDEGVNALSTVARDPSI
FT                   IDRFSMPDLSEHERWLRRYEEYKRRPLPQSQTSIRRKGLSLLNYAVKVLTQGVGRKRLD
FT                   RSRASNGVRLPAIASSIGEDALISRRYVFLPLQVSGDTQIKLHSDVDNLEAIRIALELA
FT                   ESEGMDLIVKLHPAENDRAVIDEIARLQTIHQFQIVTTAAVDLIKHAAMVVTINSTVGL
FT                   EAMLYGKKVVALGRCLYREFDRDRLMKYIHGFLVDGIDYFGNGPIDPRAARRVFSNDGR
FT                   I"
     MTIAVVIDSL ERFYFVRRLV KALDKEGDFV FMTSEPLAHL FFRLEGRHSI YLRRAKNNSS        60
     GLAYGSSLFD RSIEVMNGTI DAHVARQDWM ATFTAALDVF NRLAITVCVM WNGQQLICRA       120
     VGHACSTYGV RVRFLELSNL PEKLFADDEG VNALSTVARD PSIIDRFSMP DLSEHERWLR       180
     RYEEYKRRPL PQSQTSIRRK GLSLLNYAVK VLTQGVGRKR LDRSRASNGV RLPAIASSIG       240
     EDALISRRYV FLPLQVSGDT QIKLHSDVDN LEAIRIALEL AESEGMDLIV KLHPAENDRA       300
     VIDEIARLQT IHQFQIVTTA AVDLIKHAAM VVTINSTVGL EAMLYGKKVV ALGRCLYREF       360
     DRDRLMKYIH GFLVDGIDYF GNGPIDPRAA RRVFSNDGRI                             400
//

If you have problems or comments...

PBIL Back to PBIL home page