(data stored in ACNUC29543 zone)

EMBL: CP001044.PE16

CP001044.PE16        Location/Qualifiers
FT   CDS             complement(11487..12611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3117"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   rme:Rmet_1823 heat shock protein DnaJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3117"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72285"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR59"
FT                   /protein_id="ACC72285.1"
FT                   /translation="MKIHSHYDNLKVSRDAPQEVIRAAYKILCQKYHPDRRIDDPDAER
FT                   VMKIINASYAVLSDPVQRKEHDEWLARKEREAAAAAAVPAQSKSPQTTRRTNSQTATQT
FT                   KREASPRRQPRSSAWTSQARVDPRAAPSRPAAAGFSLRKISLRSWIAIGLCAFFGYVAI
FT                   SESMTPWPFTRNTSSSYGSHYGSPYGSRDQGGADGATSAEGKRRALATLSSAQAATSPW
FT                   TNDASAGGDASSARPAFARPAVAPNGLPWPSTAAYLEGMPVGADGGHSSVTIDNTPNRF
FT                   DVFAKLVFNASVFDQPVRHFYIPAGKSFTLLGVAPGSYDVRYQNLDDGGLYKSQNFAVT
FT                   EQDSGNGIDATNVSITLYAVPGTVQPTTIGRGDF"
     MKIHSHYDNL KVSRDAPQEV IRAAYKILCQ KYHPDRRIDD PDAERVMKII NASYAVLSDP        60
     VQRKEHDEWL ARKEREAAAA AAVPAQSKSP QTTRRTNSQT ATQTKREASP RRQPRSSAWT       120
     SQARVDPRAA PSRPAAAGFS LRKISLRSWI AIGLCAFFGY VAISESMTPW PFTRNTSSSY       180
     GSHYGSPYGS RDQGGADGAT SAEGKRRALA TLSSAQAATS PWTNDASAGG DASSARPAFA       240
     RPAVAPNGLP WPSTAAYLEG MPVGADGGHS SVTIDNTPNR FDVFAKLVFN ASVFDQPVRH       300
     FYIPAGKSFT LLGVAPGSYD VRYQNLDDGG LYKSQNFAVT EQDSGNGIDA TNVSITLYAV       360
     PGTVQPTTIG RGDF                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page