(data stored in ACNUC29543 zone)

EMBL: CP001044.PE164

CP001044.PE164       Location/Qualifiers
FT   CDS             complement(204356..204793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3277"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: pfo:Pfl_3845 protein tyrosine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3277"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72433"
FT                   /db_xref="GOA:B2JS56"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS56"
FT                   /protein_id="ACC72433.1"
FT                   /translation="MVINDILVTCTGNICRSPTAEIILRHRLAARSISVTSAGISALVG
FT                   RPICDKAAEILAENGHSSVTHRAKQVTPTMLRQSDLILTMSHRQRNHICSMMPEVRGKV
FT                   FLLGKWDAGIEIPDPYRRDRRRYEHIYGLIEKTVESWLMHL"
     MVINDILVTC TGNICRSPTA EIILRHRLAA RSISVTSAGI SALVGRPICD KAAEILAENG        60
     HSSVTHRAKQ VTPTMLRQSD LILTMSHRQR NHICSMMPEV RGKVFLLGKW DAGIEIPDPY       120
     RRDRRRYEHI YGLIEKTVES WLMHL                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page