(data stored in ACNUC29543 zone)

EMBL: CP001044.PE166

CP001044.PE166       Location/Qualifiers
FT   CDS             206229..207485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3279"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72435"
FT                   /db_xref="GOA:B2JS58"
FT                   /db_xref="InterPro:IPR014550"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS58"
FT                   /protein_id="ACC72435.1"
FT                   /translation="MVTPCAISNTHTGSNRTTAPHSRLTETALRAARAPSRRGVLLKKQ
FT                   KKAEKRMQIPKNRLIELDFFRGLVLLFIVVDHIGGSILSRATLHAYALCDAAEVFVFLG
FT                   GFATATAYASLAKRHTEADARNRFFKRSLELYRAFLVTAVLMLVVSAVMSAFSIDAPNM
FT                   ATTDLDDMMDTPTAVLRDILLFRRQPYLASVLPMYAFFAFAVPVILPLARSKPWLLLAG
FT                   SLAVWGIAPSILPHLPVAENAQWDFNPFAWQLMFVLGVIAQTQPVYQRTSAHRYGWLVT
FT                   ALACGIVAAAAWFKLFVEVTPLDSSLKQNLSWLRAMNFLAIAWLVANMVRLGWARTIAQ
FT                   RLPWVGLVGRKGLLCFVAGTVISLVVDSLLYTATDGYLNLPLGLLADAVAIGSLFAVAK
FT                   ASVPISRVLTPRLHGSGPA"
     MVTPCAISNT HTGSNRTTAP HSRLTETALR AARAPSRRGV LLKKQKKAEK RMQIPKNRLI        60
     ELDFFRGLVL LFIVVDHIGG SILSRATLHA YALCDAAEVF VFLGGFATAT AYASLAKRHT       120
     EADARNRFFK RSLELYRAFL VTAVLMLVVS AVMSAFSIDA PNMATTDLDD MMDTPTAVLR       180
     DILLFRRQPY LASVLPMYAF FAFAVPVILP LARSKPWLLL AGSLAVWGIA PSILPHLPVA       240
     ENAQWDFNPF AWQLMFVLGV IAQTQPVYQR TSAHRYGWLV TALACGIVAA AAWFKLFVEV       300
     TPLDSSLKQN LSWLRAMNFL AIAWLVANMV RLGWARTIAQ RLPWVGLVGR KGLLCFVAGT       360
     VISLVVDSLL YTATDGYLNL PLGLLADAVA IGSLFAVAKA SVPISRVLTP RLHGSGPA         418
//

If you have problems or comments...

PBIL Back to PBIL home page