(data stored in ACNUC29543 zone)

EMBL: CP001044.PE168

CP001044.PE168       Location/Qualifiers
FT   CDS             209021..209308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3281"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72437"
FT                   /db_xref="InterPro:IPR021769"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS60"
FT                   /protein_id="ACC72437.1"
FT                   /translation="MTTLDCLPLIGANGLRIEILEHSDTTLVIRWVEPGRCHYGEQRWR
FT                   RRSAHTSGTCAVSRRKIRRGDAVFKPAERPAPANASAMIAAEVLEHALAA"
     MTTLDCLPLI GANGLRIEIL EHSDTTLVIR WVEPGRCHYG EQRWRRRSAH TSGTCAVSRR        60
     KIRRGDAVFK PAERPAPANA SAMIAAEVLE HALAA                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page