(data stored in ACNUC29543 zone)

EMBL: CP001044.PE169

CP001044.PE169       Location/Qualifiers
FT   CDS             complement(209356..210291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3282"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bxe:Bxe_B0824 putative lipase (esterase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3282"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72438"
FT                   /db_xref="GOA:B2JS61"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS61"
FT                   /protein_id="ACC72438.1"
FT                   /translation="MLEPEIVEFVERTKRLYPADRSASTPAEQRAMYERLAAAFTPPLP
FT                   DGVTTQDALFMPPASGQSFMLRLYVPTDRARASGTVLYFHGGGFVVGSLASHELITARI
FT                   AADTGLCVVAVDYRLAPEHPAPAAHDDCLAVTRAALDGSLPFSALPRSLQLAGDSAGGT
FT                   LAASVALRLRDEGVPGVRGLALVYPMLGIEPQLPARDTEADAPMLTLADVRRYGELYWR
FT                   GRPVDTWTVPLEASRYDGLPPTLAIGVEHDPLRDDARVFAERIVAARGRVDAPIGRGLV
FT                   HGAWRALATSPGVQWMHREVCRFLSAHAAD"
     MLEPEIVEFV ERTKRLYPAD RSASTPAEQR AMYERLAAAF TPPLPDGVTT QDALFMPPAS        60
     GQSFMLRLYV PTDRARASGT VLYFHGGGFV VGSLASHELI TARIAADTGL CVVAVDYRLA       120
     PEHPAPAAHD DCLAVTRAAL DGSLPFSALP RSLQLAGDSA GGTLAASVAL RLRDEGVPGV       180
     RGLALVYPML GIEPQLPARD TEADAPMLTL ADVRRYGELY WRGRPVDTWT VPLEASRYDG       240
     LPPTLAIGVE HDPLRDDARV FAERIVAARG RVDAPIGRGL VHGAWRALAT SPGVQWMHRE       300
     VCRFLSAHAA D                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page