(data stored in ACNUC29543 zone)

EMBL: CP001044.PE173

CP001044.PE173       Location/Qualifiers
FT   CDS             complement(212955..213905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3286"
FT                   /product="choline ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="TIGRFAM: choline ABC transporter, periplasmic
FT                   binding protein; PFAM: Substrate-binding region of ABC-type
FT                   glycine betaine transport system; KEGG: bxe:Bxe_B0828 ABC
FT                   glycine betaine transporter, periplasmic ligand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3286"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72442"
FT                   /db_xref="GOA:B2JS65"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS65"
FT                   /protein_id="ACC72442.1"
FT                   /translation="MKWINQAVSACLASLLAALSLPALAQDPPTCRAVHFADIGWTDIT
FT                   STTALASTVFEGLGYQPVTTVASVPISFAGLKSKQLDVSLGYWWPVQEKAIAPFVEAKS
FT                   INVLQPPNLTGAKATFAVPTYEYDAGLKTFADIAKHRAELDGKIYGIEPGSSANAAIQK
FT                   MIATNQFGLGGFKLIESSEAGMLVTVDRAVREKKWVVFLGWQPHPMNIQIDMKYLSGSE
FT                   GVFGPNDGEARVYTLTSPDFLTRCPNAGKLVSNLRFTTQLENVVMQSVMNKEKPSEAAK
FT                   AYLKKNPQVLDEWLAGVKTYDGKDGLPAVKAYLGL"
     MKWINQAVSA CLASLLAALS LPALAQDPPT CRAVHFADIG WTDITSTTAL ASTVFEGLGY        60
     QPVTTVASVP ISFAGLKSKQ LDVSLGYWWP VQEKAIAPFV EAKSINVLQP PNLTGAKATF       120
     AVPTYEYDAG LKTFADIAKH RAELDGKIYG IEPGSSANAA IQKMIATNQF GLGGFKLIES       180
     SEAGMLVTVD RAVREKKWVV FLGWQPHPMN IQIDMKYLSG SEGVFGPNDG EARVYTLTSP       240
     DFLTRCPNAG KLVSNLRFTT QLENVVMQSV MNKEKPSEAA KAYLKKNPQV LDEWLAGVKT       300
     YDGKDGLPAV KAYLGL                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page