(data stored in ACNUC29543 zone)

EMBL: CP001044.PE176

CP001044.PE176       Location/Qualifiers
FT   CDS             complement(216671..217636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3289"
FT                   /product="choline ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="TIGRFAM: choline ABC transporter, periplasmic
FT                   binding protein; PFAM: Substrate-binding region of ABC-type
FT                   glycine betaine transport system; KEGG: bxe:Bxe_B1572 ABC
FT                   proline/glycine betaine transporter, periplasmic ligand
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3289"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72445"
FT                   /db_xref="GOA:B2JS68"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS68"
FT                   /protein_id="ACC72445.1"
FT                   /translation="MNTRWRSSLAKAALIFSAFGMAVTGSSHAAEPQSCTQVRMADPGW
FT                   TDIDATNAVAGVLLKALGYQQNVSNLSVPITYQGLKKGQIDVFLGNWMPAQGPLVKPFV
FT                   DEHSIDVLHANLTNAKFTLAVPDYVAAAGVHSFADLVKHADQFNGKIYGIEPGAPANQN
FT                   IKKMIADKAFGLGDWKVVESSETGMLTQVERAVRDKQWIVFLAWEPHLMNTKFHLTYLS
FT                   GGDAYFGPNYGGATVNTVTRPGFAGQCTNLAKLFQQMTFNVDMENQIIANVLQNKVDIN
FT                   TAALTALKGNPALLNTWLKGVTTTNGADGLQAVQTQLGIH"
     MNTRWRSSLA KAALIFSAFG MAVTGSSHAA EPQSCTQVRM ADPGWTDIDA TNAVAGVLLK        60
     ALGYQQNVSN LSVPITYQGL KKGQIDVFLG NWMPAQGPLV KPFVDEHSID VLHANLTNAK       120
     FTLAVPDYVA AAGVHSFADL VKHADQFNGK IYGIEPGAPA NQNIKKMIAD KAFGLGDWKV       180
     VESSETGMLT QVERAVRDKQ WIVFLAWEPH LMNTKFHLTY LSGGDAYFGP NYGGATVNTV       240
     TRPGFAGQCT NLAKLFQQMT FNVDMENQII ANVLQNKVDI NTAALTALKG NPALLNTWLK       300
     GVTTTNGADG LQAVQTQLGI H                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page