(data stored in ACNUC29543 zone)

EMBL: CP001044.PE178

CP001044.PE178       Location/Qualifiers
FT   CDS             219364..220290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3291"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="TIGRFAM: choline sulfate-utilization transcription
FT                   factor; PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bte:BTH_II1856 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3291"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72447"
FT                   /db_xref="GOA:B2JS70"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS70"
FT                   /protein_id="ACC72447.1"
FT                   /translation="MSGPDRLPPMQTLSAFESAARLASFTAAARELGSTQPAVSQRIVQ
FT                   LEEDLGAPLFERGHRGVTLTPEGALLYEAVRSGLDTIRVATSDIRARRATGALTILTDA
FT                   GFATYWLMPRLARLKASMPGVNVKIVTSQLGYDPHRDHADIAIAFGDGHWPPCTSTRLF
FT                   AEAVTAVCSPAFRHLHPAVHTAADLAELPLLHVQPTEPERWLAWNSWFAAHGLAAPGES
FT                   QGMMFNSYSLVVQAALMGQGVALGWTPLTDELVATGQLVRLLDTPVTTERGYYLVCPPA
FT                   RPAPAAVPLFRRWLFNELVDVSEHAHA"
     MSGPDRLPPM QTLSAFESAA RLASFTAAAR ELGSTQPAVS QRIVQLEEDL GAPLFERGHR        60
     GVTLTPEGAL LYEAVRSGLD TIRVATSDIR ARRATGALTI LTDAGFATYW LMPRLARLKA       120
     SMPGVNVKIV TSQLGYDPHR DHADIAIAFG DGHWPPCTST RLFAEAVTAV CSPAFRHLHP       180
     AVHTAADLAE LPLLHVQPTE PERWLAWNSW FAAHGLAAPG ESQGMMFNSY SLVVQAALMG       240
     QGVALGWTPL TDELVATGQL VRLLDTPVTT ERGYYLVCPP ARPAPAAVPL FRRWLFNELV       300
     DVSEHAHA                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page