(data stored in ACNUC29543 zone)

EMBL: CP001044.PE18

CP001044.PE18        Location/Qualifiers
FT   CDS             complement(14272..14484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3119"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0963 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3119"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72287"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR61"
FT                   /protein_id="ACC72287.1"
FT                   /translation="MTIPMLTTHRGYRLQASAAIGDDGLHAADLTIEKPGLPPRTFNAL
FT                   DYFYDGEQALKYATAWGRIWVDMTG"
     MTIPMLTTHR GYRLQASAAI GDDGLHAADL TIEKPGLPPR TFNALDYFYD GEQALKYATA        60
     WGRIWVDMTG                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page