(data stored in ACNUC29543 zone)

EMBL: CP001044.PE180

CP001044.PE180       Location/Qualifiers
FT   CDS             complement(221371..223038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3293"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bam:Bamb_4487 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3293"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72449"
FT                   /db_xref="GOA:B2JS72"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS72"
FT                   /protein_id="ACC72449.1"
FT                   /translation="MDQSGLRTRSIEGASKGTNEGAAHEGHALQRGLTWKDAFWVTSGV
FT                   PGGVLFTIGGVSATIGQPAWSIWVAAILMGLIQSATYAEISGLFPHKSGGASVYGAMAW
FT                   VRYSKTIAPVSVWCNWLAWSPMLALGTGLAANYALSSLYAPDAAINTWRLTLLDLGFIK
FT                   QGLSLRINATFIIAAIFLLITFKLQHSGASKAARTQRILGIASLAPLLIVGIVPFVTGD
FT                   VPAAHLWPLLPLGHDAQGNVTAATFGSWNGAGITMAFGAMFMAGWAAYGFETAVCYTRE
FT                   FRNPRTDTAKAIFWSGMACLLVMTLVPLAFQGVLGTKGMLDPKIADGTGVAAAMAHMVG
FT                   GGAIVFDVVVVMLILTILLIVMTSMMGSSRTLYQASVDGWLPKYLSHVNEHGAPTRAMW
FT                   TDLGFNLVLLLMSDYMTVLSISNVCYMIFVFLNLQSGWIHRLDRADADRPFRCPTWLLA
FT                   AGALCGYLDLAFIGAGADMQGVGTMRNGLIAMLLIVPVFMFRHYWQDRGRFPARMQQDM
FT                   EWKGGARPAGLRGVLPYGALLFAVFVVWFSHHLAKPFL"
     MDQSGLRTRS IEGASKGTNE GAAHEGHALQ RGLTWKDAFW VTSGVPGGVL FTIGGVSATI        60
     GQPAWSIWVA AILMGLIQSA TYAEISGLFP HKSGGASVYG AMAWVRYSKT IAPVSVWCNW       120
     LAWSPMLALG TGLAANYALS SLYAPDAAIN TWRLTLLDLG FIKQGLSLRI NATFIIAAIF       180
     LLITFKLQHS GASKAARTQR ILGIASLAPL LIVGIVPFVT GDVPAAHLWP LLPLGHDAQG       240
     NVTAATFGSW NGAGITMAFG AMFMAGWAAY GFETAVCYTR EFRNPRTDTA KAIFWSGMAC       300
     LLVMTLVPLA FQGVLGTKGM LDPKIADGTG VAAAMAHMVG GGAIVFDVVV VMLILTILLI       360
     VMTSMMGSSR TLYQASVDGW LPKYLSHVNE HGAPTRAMWT DLGFNLVLLL MSDYMTVLSI       420
     SNVCYMIFVF LNLQSGWIHR LDRADADRPF RCPTWLLAAG ALCGYLDLAF IGAGADMQGV       480
     GTMRNGLIAM LLIVPVFMFR HYWQDRGRFP ARMQQDMEWK GGARPAGLRG VLPYGALLFA       540
     VFVVWFSHHL AKPFL                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page