(data stored in ACNUC29543 zone)

EMBL: CP001044.PE181

CP001044.PE181       Location/Qualifiers
FT   CDS             complement(223175..224038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3294"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: bch:Bcen2424_5076
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3294"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72450"
FT                   /db_xref="GOA:B2JS73"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS73"
FT                   /protein_id="ACC72450.1"
FT                   /translation="MKHLKKLMLCGALIATMTAIGTAAADTKPTIKIGYVEGWDDSVAT
FT                   SNVAAQIIEKRLGYPVQLVPVAAGIMWQGVARGDLDATLSAWLPVTHGAYWDQFKGKVQ
FT                   DLGANYTDAKIGLIVPADVPEKSISDLQAHKADFSGRIVGIDAGAGVMKKTSEAIKAYN
FT                   LDYQLMPSSGSAMTAELARSMNANKPVIVTGWVPHWMFAKWKLKFLEDPKKVYGESEHV
FT                   DSVVNPGLDAKAPQVVAFLKKFQWKPGEIDSVMLATENGAKPADAAGSWIAAHGDRVNS
FT                   WVGGAQ"
     MKHLKKLMLC GALIATMTAI GTAAADTKPT IKIGYVEGWD DSVATSNVAA QIIEKRLGYP        60
     VQLVPVAAGI MWQGVARGDL DATLSAWLPV THGAYWDQFK GKVQDLGANY TDAKIGLIVP       120
     ADVPEKSISD LQAHKADFSG RIVGIDAGAG VMKKTSEAIK AYNLDYQLMP SSGSAMTAEL       180
     ARSMNANKPV IVTGWVPHWM FAKWKLKFLE DPKKVYGESE HVDSVVNPGL DAKAPQVVAF       240
     LKKFQWKPGE IDSVMLATEN GAKPADAAGS WIAAHGDRVN SWVGGAQ                     287
//

If you have problems or comments...

PBIL Back to PBIL home page