(data stored in ACNUC29543 zone)

EMBL: CP001044.PE182

CP001044.PE182       Location/Qualifiers
FT   CDS             complement(224237..225394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3295"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: bam:Bamb_4489 oxidoreductase FAD-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3295"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72451"
FT                   /db_xref="GOA:B2JS74"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS74"
FT                   /protein_id="ACC72451.1"
FT                   /translation="MMRDGAPFEPVESRVTKPEFWSALPARWTSDVEETLVCCQVRQET
FT                   HDVKSFFFRSPEGRAFVFEPGQFITLELDIEGETINRCYTISSPPTRPHTISITVKRVP
FT                   GGKVSNWLHDNLQAGARVRVLGPAGEFTCARHPARKYLFLSAGSGITPLMSMSRAHHEL
FT                   SEDRDIVFVHSARTPDDIIFPRELDLIASNQANFRTSFVCERVGARTSWPGITGFLTLP
FT                   LLKLIAPDFMEREVFTCGPAPYMKAVRDLLDEAGFDRKQYHEESFSFETLIEAEPQVAA
FT                   EVLEAEQKSHADGANGAQTFSVSFARSNRSIECGSTQHVLDAARQAGVRLPASCTQGMC
FT                   GTCKVKLVSGQVDMKHNGGIRQREIDQGMVLLCCSKPLSDLVVDK"
     MMRDGAPFEP VESRVTKPEF WSALPARWTS DVEETLVCCQ VRQETHDVKS FFFRSPEGRA        60
     FVFEPGQFIT LELDIEGETI NRCYTISSPP TRPHTISITV KRVPGGKVSN WLHDNLQAGA       120
     RVRVLGPAGE FTCARHPARK YLFLSAGSGI TPLMSMSRAH HELSEDRDIV FVHSARTPDD       180
     IIFPRELDLI ASNQANFRTS FVCERVGART SWPGITGFLT LPLLKLIAPD FMEREVFTCG       240
     PAPYMKAVRD LLDEAGFDRK QYHEESFSFE TLIEAEPQVA AEVLEAEQKS HADGANGAQT       300
     FSVSFARSNR SIECGSTQHV LDAARQAGVR LPASCTQGMC GTCKVKLVSG QVDMKHNGGI       360
     RQREIDQGMV LLCCSKPLSD LVVDK                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page