(data stored in ACNUC29543 zone)

EMBL: CP001044.PE186

CP001044.PE186       Location/Qualifiers
FT   CDS             complement(228727..230646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3299"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224 cysteine-rich
FT                   region domain protein; KEGG: bte:BTH_II1864 iron-sulfur
FT                   cluster binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3299"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72455"
FT                   /db_xref="GOA:B2JS78"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021872"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS78"
FT                   /protein_id="ACC72455.1"
FT                   /translation="MSPAFLITALLWVSVAGLAFAVAKRAAYWRLGRATAAGAFGWTNL
FT                   LTIPKRYFVDLHHVVARDPYIAKTHVATAGGAIAAFALVFINYGLAIYSPWLDRLIFLA
FT                   ALIMLVGAVFVWRRRHAKDVPARLSRGPWNTLPWLLGSFALGLLLYTLLPASAMSGGLA
FT                   ILFAVLIGVGAFTMTFGAARGGPMKHALAGLLHLAFHPRQERFAAQGDVRKEQAIPPTA
FT                   LKAPVLEQNEYGVGKPVEFRWNQLLSFDACVQCGKCEAACPAFAAGQPLNPKKLIQDLV
FT                   TGMVGGNDAAYAGSPTPGIKVGQHGGEPQRPIISSLIEADTVWSCTTCRACVHECPMLI
FT                   EHVDAIVDMRRNQTLVHGTVPGKGPEVLANLRETGTMGGYDKAARYDWSVDLSSPVAQP
FT                   GQAVDVLLVAGEGAFDMRYQRTLRSLVKVLNKAGVKYAVLGSQETDTGDVARRLGDEAT
FT                   FQRMAKQMMGTLSALNFKRIVTADPHVMHSLRNEYRALGGRYEVLHHTTFLAELVASGK
FT                   LSPKAVAAFNDKKITYHDPCYLGRYNGETEAPRQLLKTIGIKVVEMERHGKRGRCCGGG
FT                   GGAPLTDIPGKQRIPDIRINDARSIGADVVAVGCPNCTAMLEGVVGPRPEVLDVAELVA
FT                   AALE"
     MSPAFLITAL LWVSVAGLAF AVAKRAAYWR LGRATAAGAF GWTNLLTIPK RYFVDLHHVV        60
     ARDPYIAKTH VATAGGAIAA FALVFINYGL AIYSPWLDRL IFLAALIMLV GAVFVWRRRH       120
     AKDVPARLSR GPWNTLPWLL GSFALGLLLY TLLPASAMSG GLAILFAVLI GVGAFTMTFG       180
     AARGGPMKHA LAGLLHLAFH PRQERFAAQG DVRKEQAIPP TALKAPVLEQ NEYGVGKPVE       240
     FRWNQLLSFD ACVQCGKCEA ACPAFAAGQP LNPKKLIQDL VTGMVGGNDA AYAGSPTPGI       300
     KVGQHGGEPQ RPIISSLIEA DTVWSCTTCR ACVHECPMLI EHVDAIVDMR RNQTLVHGTV       360
     PGKGPEVLAN LRETGTMGGY DKAARYDWSV DLSSPVAQPG QAVDVLLVAG EGAFDMRYQR       420
     TLRSLVKVLN KAGVKYAVLG SQETDTGDVA RRLGDEATFQ RMAKQMMGTL SALNFKRIVT       480
     ADPHVMHSLR NEYRALGGRY EVLHHTTFLA ELVASGKLSP KAVAAFNDKK ITYHDPCYLG       540
     RYNGETEAPR QLLKTIGIKV VEMERHGKRG RCCGGGGGAP LTDIPGKQRI PDIRINDARS       600
     IGADVVAVGC PNCTAMLEGV VGPRPEVLDV AELVAAALE                              639
//

If you have problems or comments...

PBIL Back to PBIL home page