(data stored in ACNUC29543 zone)

EMBL: CP001044.PE187

CP001044.PE187       Location/Qualifiers
FT   CDS             complement(230649..232712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3300"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bxe:Bxe_B1582 NADH-flavin
FT                   oxidoreductase / NADH oxidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3300"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72456"
FT                   /db_xref="GOA:B2JS79"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS79"
FT                   /protein_id="ACC72456.1"
FT                   /translation="MRYPNLFKPLTLNQLTLRNRIVSTAHAEVYAEPGGLPGDRYIRYY
FT                   EEKAKGGVGLAVCGGSSPVSIDSPQGWWKSVNLSTDKIIDPLSRLAEAMHRHGAKIMIQ
FT                   ATHMGRRSAFHGEHWPHLMTPSGVREPVHRGNAKIIEVEEIRRIIGDFAAAAKRVKDAG
FT                   MDGIEISAAHQHLIDQFWSPRTNFRTDEWGGSLQNRLRFGVEVLQAVREAVGKDFCVGL
FT                   RMCGDEFHEDGLDHTQLKEIAQAMAETGLIDYIGVIGSGADTHNTLANCMPPMALPPEP
FT                   FVHLAAGIKSVVKLPIMHAQSIRDAGQAERLLANGMVDLVGMTRAQIADPHMVIKIRDG
FT                   REDEIKQCVGANYCIDRQYNGLDVLCVQNAATSREATMPHVIEKTRGPRRKVVVVGAGP
FT                   AGLEAARVARSRGHDVVLFEKGDAVGGQIMLAAKAPQREQMAGIVRWFDMETKRLGVDR
FT                   RMGVEADEKMILAEKPDIIVLATGGSAFTQQVPAWGVAEGLAVSSWDILSGKVEPGQNV
FT                   LVYDGVSTHAGAGVADFISSRGSKVEIVTPDVKVADDVGGTTFPIFYRRLYAQGVIHTP
FT                   NYWLDRVYEEDGKKIAVIRNEYTEEREERAVDQVVIENGSTPNDGLYWKLKNESVNRGQ
FT                   VDVHKLFASEPQPSLSEELGNGRFLLFRVGDCISMHNIHGAIYDALRLCKDF"
     MRYPNLFKPL TLNQLTLRNR IVSTAHAEVY AEPGGLPGDR YIRYYEEKAK GGVGLAVCGG        60
     SSPVSIDSPQ GWWKSVNLST DKIIDPLSRL AEAMHRHGAK IMIQATHMGR RSAFHGEHWP       120
     HLMTPSGVRE PVHRGNAKII EVEEIRRIIG DFAAAAKRVK DAGMDGIEIS AAHQHLIDQF       180
     WSPRTNFRTD EWGGSLQNRL RFGVEVLQAV REAVGKDFCV GLRMCGDEFH EDGLDHTQLK       240
     EIAQAMAETG LIDYIGVIGS GADTHNTLAN CMPPMALPPE PFVHLAAGIK SVVKLPIMHA       300
     QSIRDAGQAE RLLANGMVDL VGMTRAQIAD PHMVIKIRDG REDEIKQCVG ANYCIDRQYN       360
     GLDVLCVQNA ATSREATMPH VIEKTRGPRR KVVVVGAGPA GLEAARVARS RGHDVVLFEK       420
     GDAVGGQIML AAKAPQREQM AGIVRWFDME TKRLGVDRRM GVEADEKMIL AEKPDIIVLA       480
     TGGSAFTQQV PAWGVAEGLA VSSWDILSGK VEPGQNVLVY DGVSTHAGAG VADFISSRGS       540
     KVEIVTPDVK VADDVGGTTF PIFYRRLYAQ GVIHTPNYWL DRVYEEDGKK IAVIRNEYTE       600
     EREERAVDQV VIENGSTPND GLYWKLKNES VNRGQVDVHK LFASEPQPSL SEELGNGRFL       660
     LFRVGDCISM HNIHGAIYDA LRLCKDF                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page