(data stored in ACNUC29543 zone)

EMBL: CP001044.PE19

CP001044.PE19        Location/Qualifiers
FT   CDS             complement(14658..15689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3120"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="TIGRFAM: phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: bxe:Bxe_A1266 ABC
FT                   phosphate transporter, periplasmic ligand binding protein,
FT                   PstS"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3120"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72288"
FT                   /db_xref="GOA:B2JR62"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR62"
FT                   /protein_id="ACC72288.1"
FT                   /translation="MRHALFAAAGLLGALSFSFAHATDVTGAGSTFAAPVYTKWADAYQ
FT                   KAGGGRINYQGIGSSGGIKQVLAKTVDFAGSDAPLKDDELAKDGLFQFPTVVGGVVPVV
FT                   NLRGIKPGGLVLSGPVLGDIYLGKIKKWNDPQIAALNSGAKLPDTDIAVVRRADGSGTS
FT                   FIWTHYLAQVSPEWKSKVGEGTTVNWPTGTGGKGNDGVAAFVQRLPGAIGYVEWAYAKQ
FT                   NKMTYTSLKNAAGAVVEPKTETFKAAAAGAEWSKSFYQILTNEPGKDAWPVVGATFVLV
FT                   HSAQDKPDHGKETLKFFDWAFRNGSQTAQELDYITLPDAVVSEIRAQWKAKVKDASGKP
FT                   IAD"
     MRHALFAAAG LLGALSFSFA HATDVTGAGS TFAAPVYTKW ADAYQKAGGG RINYQGIGSS        60
     GGIKQVLAKT VDFAGSDAPL KDDELAKDGL FQFPTVVGGV VPVVNLRGIK PGGLVLSGPV       120
     LGDIYLGKIK KWNDPQIAAL NSGAKLPDTD IAVVRRADGS GTSFIWTHYL AQVSPEWKSK       180
     VGEGTTVNWP TGTGGKGNDG VAAFVQRLPG AIGYVEWAYA KQNKMTYTSL KNAAGAVVEP       240
     KTETFKAAAA GAEWSKSFYQ ILTNEPGKDA WPVVGATFVL VHSAQDKPDH GKETLKFFDW       300
     AFRNGSQTAQ ELDYITLPDA VVSEIRAQWK AKVKDASGKP IAD                         343
//

If you have problems or comments...

PBIL Back to PBIL home page