(data stored in ACNUC29543 zone)

EMBL: CP001044.PE191

CP001044.PE191       Location/Qualifiers
FT   CDS             236125..237141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3304"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG:
FT                   bvi:Bcep1808_3424 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3304"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72460"
FT                   /db_xref="GOA:B2JS83"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2JS83"
FT                   /protein_id="ACC72460.1"
FT                   /translation="MSPDRTASLSHFAFMPLPNFTMIAFTNAIEVLRMANYLSGQPLYR
FT                   WSIISPGGGSVTASNGLSVDTGPAECVGTPDIVFVCGGIDVQRETTPEHLSTLRRFARA
FT                   GVALGSLCTGTYALAKSGLLAGYACAIHWENMSALKEEFPDTRFLKELFVIDRDRVTCT
FT                   GGVAPLDMMLNLIAARVGTPRVTQIAEQFIVEHVRDTSAQQRMPLVARLGSANKSLFEV
FT                   IALMENNIEEPLSREELARLANMSQRQLQRLFREHLGMTPTHYYLTLRLRRARELLLQT
FT                   DMSIMHITMACGFQSACHFSKSYRDAFGTAPTRERRKQVAPLAHPVMGVLAGSPLHA"
     MSPDRTASLS HFAFMPLPNF TMIAFTNAIE VLRMANYLSG QPLYRWSIIS PGGGSVTASN        60
     GLSVDTGPAE CVGTPDIVFV CGGIDVQRET TPEHLSTLRR FARAGVALGS LCTGTYALAK       120
     SGLLAGYACA IHWENMSALK EEFPDTRFLK ELFVIDRDRV TCTGGVAPLD MMLNLIAARV       180
     GTPRVTQIAE QFIVEHVRDT SAQQRMPLVA RLGSANKSLF EVIALMENNI EEPLSREELA       240
     RLANMSQRQL QRLFREHLGM TPTHYYLTLR LRRARELLLQ TDMSIMHITM ACGFQSACHF       300
     SKSYRDAFGT APTRERRKQV APLAHPVMGV LAGSPLHA                               338
//

If you have problems or comments...

PBIL Back to PBIL home page